StarFunc result for job id Q96LX8

User Input

>input (424 residues)
MASMPPTPEAQGPILFEDLAVYFSQEECVTLHPAQRSLSKDGTKESLEDAALMGEEGKPE
INQQLSLESMELDELALEKYPIAAPLVPYPEKSSEDGVGNPEAKILSGTPTYKRRVISLL
VTIENHTPLVELSEYLGTNTLSEILDSPWEGAKNVYKCPECDQNFSDHSYLVLHQKIHSG
EKKHKCGDCGKIFNHRANLRTHRRIHTGEKPYKCAKCSASFRQHSHLSRHMNSHVKEKPY
TCSICGRGFMWLPGLAQHQKSHSAENTYESTNCDKHFNEKPNLALPEETFVSGPQYQHTK
CMKSFRQSLYPALSEKSHDEDSERCSDDGDNFFSFSKFKPLQCPDCDMTFPCFSELISHQ
NIHTEERPHKCKTCEESFALDSELACHQKSHMLAEPFKCTVCGKTFKSNLHLITHKRTHI
KNTT

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q96LX8	1.000	1.000	9.591E-73	424	1.000	1.000	Q96LX8.pdb.gz	ZN597_HUMAN Zinc finger protein 597 OS=Homo sapiens OX=9606 GN=ZNF597 PE=1 SV=1
2	AFDB:Q8IVP9	0.287	0.301	9.166E-23	402	0.304	0.321	Q8IVP9.pdb.gz	ZN547_HUMAN Zinc finger protein 547 OS=Homo sapiens OX=9606 GN=ZNF547 PE=1 SV=2
3	AFDB:Q9HCL3	0.288	0.236	2.324E-22	533	0.283	0.225	Q9HCL3.pdb.gz	ZFP14_HUMAN Zinc finger protein 14 homolog OS=Homo sapiens OX=9606 GN=ZFP14 PE=1 SV=2
4	AFDB:P17040	0.231	0.102	3.589E-22	1043	0.309	0.126	P17040.pdb.gz	ZSC20_HUMAN Zinc finger and SCAN domain-containing protein 20 OS=Homo sapiens OX=9606 GN=ZSCAN20 PE=1 SV=3
5	AFDB:Q8CIP9	0.241	0.348	4.063E-22	271	0.238	0.373	Q8CIP9.pdb.gz	Q8CIP9_MOUSE KRAB zinc finger protein 6D (Fragment) OS=Mus musculus OX=10090 GN=Zfp640 PE=2 SV=1
6	AFDB:Q61967	0.208	0.150	5.540E-22	636	0.314	0.209	Q61967.pdb.gz	ZFP90_MOUSE Zinc finger protein 90 OS=Mus musculus OX=10090 GN=Zfp90 PE=1 SV=1
7	AFDB:Q9P0L1	0.265	0.162	6.272E-22	754	0.302	0.170	Q9P0L1.pdb.gz	ZKSC7_HUMAN Zinc finger protein with KRAB and SCAN domains 7 OS=Homo sapiens OX=9606 GN=ZKSCAN7 PE=1 SV=2
8	AFDB:Q9Y2L8	0.236	0.126	7.101E-22	839	0.274	0.138	Q9Y2L8.pdb.gz	ZKSC5_HUMAN Zinc finger protein with KRAB and SCAN domains 5 OS=Homo sapiens OX=9606 GN=ZKSCAN5 PE=1 SV=1
9	AFDB:P35789	0.286	0.204	1.096E-21	620	0.276	0.189	P35789.pdb.gz	ZNF93_HUMAN Zinc finger protein 93 OS=Homo sapiens OX=9606 GN=ZNF93 PE=1 SV=4
10	AFDB:P17023	0.291	0.274	1.591E-21	458	0.278	0.258	P17023.pdb.gz	ZNF19_HUMAN Zinc finger protein 19 OS=Homo sapiens OX=9606 GN=ZNF19 PE=1 SV=4
11	PDB:3w5kB	0.119	0.290	6.792E-4	110	0.087	0.336	3w5kB.pdb.gz	Structural basis for the selective nuclear import of the C2H2 zinc-finger protein Snail by importin beta.
12	PDB:1b8tA	0.048	0.075	9.647E-1	192	0.068	0.151	1b8tA.pdb.gz	Solution structure of the chicken cysteine-rich protein, CRP1, a double-LIM protein implicated in muscle differentiation.
13	PDB:7uhyC	0.075	0.061	1.026	578	0.040	0.029	7uhyC.pdb.gz	Structure of the nutrient-sensing hub GATOR2.
14	PDB:4r8pL	0.063	0.088	1.909	254	0.028	0.047	4r8pL.pdb.gz	Crystal structure of the PRC1 ubiquitylation module bound to the nucleosome.
15	PDB:7uhyD	0.059	0.079	1.909	288	0.050	0.073	7uhyD.pdb.gz	Structure of the nutrient-sensing hub GATOR2.
16	PDB:6o9lQ	0.063	0.062	2.031	430	0.099	0.098	6o9lQ.pdb.gz	Transcription preinitiation complex structure and dynamics provide insight into genetic diseases.
17	PDB:7vo0G	0.086	0.215	2.031	131	0.054	0.176	7vo0G.pdb.gz	Structural basis of Streptomyces transcription activation by zinc uptake regulator.
18	PDB:7uhyA	0.095	0.057	2.161	771	0.054	0.030	7uhyA.pdb.gz	Structure of the nutrient-sensing hub GATOR2.
19	PDB:6r5kO	0.062	0.059	2.603	447	0.050	0.047	6r5kO.pdb.gz	Molecular Basis for poly(A) RNP Architecture and Recognition by the Pan2-Pan3 Deadenylase.
20	PDB:5gm6a	0.041	0.101	2.947	123	0.033	0.114	5gm6a.pdb.gz	Structure of a yeast activated spliceosome at 3.5 angstrom resolution

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q96LX8	0.0	881	424	1.000	1.000	ZN597_HUMAN Zinc finger protein 597 OS=Homo sapiens OX=9606 GN=ZNF597 PE=1 SV=1
2	Q9C0F3	3.34e-67	223	470	0.349	0.315	ZN436_HUMAN Zinc finger protein 436 OS=Homo sapiens OX=9606 GN=ZNF436 PE=1 SV=2
3	P10755	3.15e-63	213	501	0.337	0.285	ZFP14_MOUSE Zinc finger protein 14 OS=Mus musculus OX=10090 GN=Zfp14 PE=2 SV=2
4	Q8NCK3	2.33e-62	209	441	0.344	0.331	ZN485_HUMAN Zinc finger protein 485 OS=Homo sapiens OX=9606 GN=ZNF485 PE=1 SV=1
5	Q9HCL3	4.58e-60	206	533	0.330	0.263	ZFP14_HUMAN Zinc finger protein 14 homolog OS=Homo sapiens OX=9606 GN=ZFP14 PE=1 SV=2
6	F8WEZ9	2.34e-58	200	492	0.335	0.289	F8WEZ9_HUMAN Zinc finger protein 480 OS=Homo sapiens OX=9606 GN=ZNF480 PE=1 SV=1
7	P17030	6.14e-58	198	456	0.323	0.300	ZNF25_HUMAN Zinc finger protein 25 OS=Homo sapiens OX=9606 GN=ZNF25 PE=1 SV=2
8	Q6NX45	1.83e-57	197	483	0.262	0.230	ZN774_HUMAN Zinc finger protein 774 OS=Homo sapiens OX=9606 GN=ZNF774 PE=1 SV=2
9	Q14585	2.92e-57	197	488	0.257	0.223	ZN345_HUMAN Zinc finger protein 345 OS=Homo sapiens OX=9606 GN=ZNF345 PE=1 SV=1
10	Q96HQ0	3.71e-57	197	510	0.342	0.284	ZN419_HUMAN Zinc finger protein 419 OS=Homo sapiens OX=9606 GN=ZNF419 PE=1 SV=2
11	Q6ZN57	3.77e-57	196	461	0.243	0.223	ZFP2_HUMAN Zinc finger protein ZFP2 OS=Homo sapiens OX=9606 GN=ZFP2 PE=1 SV=1
12	O88412	3.80e-57	198	524	0.243	0.197	O88412_MOUSE Zinc finger protein 105 OS=Mus musculus OX=10090 GN=Zfp105 PE=2 SV=1
13	Q8NA42	4.93e-57	196	475	0.321	0.286	ZN383_HUMAN Zinc finger protein 383 OS=Homo sapiens OX=9606 GN=ZNF383 PE=1 SV=1
14	Q8IVP9	7.50e-57	194	402	0.323	0.341	ZN547_HUMAN Zinc finger protein 547 OS=Homo sapiens OX=9606 GN=ZNF547 PE=1 SV=2
15	Q8TBZ5	1.16e-56	197	544	0.259	0.202	ZN502_HUMAN Zinc finger protein 502 OS=Homo sapiens OX=9606 GN=ZNF502 PE=1 SV=1
16	Q15937	1.42e-56	196	498	0.340	0.289	ZNF79_HUMAN Zinc finger protein 79 OS=Homo sapiens OX=9606 GN=ZNF79 PE=1 SV=2
17	Q8TAQ5	1.65e-56	199	688	0.309	0.190	ZN420_HUMAN Zinc finger protein 420 OS=Homo sapiens OX=9606 GN=ZNF420 PE=1 SV=1
18	E9QAG8	2.66e-56	196	526	0.297	0.240	ZN431_MOUSE Zinc finger protein 431 OS=Mus musculus OX=10090 GN=Znf431 PE=1 SV=1
19	Q9UEG4	3.68e-56	201	869	0.262	0.128	ZN629_HUMAN Zinc finger protein 629 OS=Homo sapiens OX=9606 GN=ZNF629 PE=1 SV=2
20	Q6ECI4	7.87e-56	198	717	0.358	0.212	ZN470_HUMAN Zinc finger protein 470 OS=Homo sapiens OX=9606 GN=ZNF470 PE=2 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF19769 CPxCG_zf	3.8e+02	12.2	CPxCG-related zinc finger
2	PF01363 FYVE	8.1	18.0	FYVE zinc finger
3	PF01352 KRAB	1.5e-07	42.2	KRAB box
4	PF00096 zf-C2H2	1.7e-21	86.5	Zinc finger, C2H2 type
5	PF13894 zf-C2H2_4	2.7e-14	63.6	C2H2-type zinc finger
6	PF13912 zf-C2H2_6	0.11	23.8	C2H2-type zinc finger
7	PF15909 zf-C2H2_8	8.4	18.1	C2H2-type zinc ribbon
8	PF12171 zf-C2H2_jaz	5	18.8	Zinc-finger double-stranded RNA-binding
9	PF13465 zf-H2C2_2	9.2e-24	94.0	Zinc-finger double domain
10	PF12874 zf-met	34	16.2	Zinc-finger of C2H2 type
11	PF18439 zf_UBZ	36	15.4	Ubiquitin-Binding Zinc Finger
12	PF17032 zinc_ribbon_15	3.2e+02	13.5	zinc-ribbon family
13	PF09723 Zn-ribbon_8	37	15.9	Zinc ribbon domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000301744

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000355077	0.876	Non-structural maintenance of chromosomes element 1 homolog
2	9606.ENSP00000385903	0.831	N-alpha-acetyltransferase 60
3	9606.ENSP00000404092	0.770	Structural maintenance of chromosomes protein 6
4	9606.ENSP00000354957	0.769	Structural maintenance of chromosomes protein 5
5	9606.ENSP00000330694	0.760	Non-structural maintenance of chromosomes element 3 homolog
6	9606.ENSP00000287437	0.759	E3 SUMO-protein ligase NSE2
7	9606.ENSP00000358019	0.757	Non-structural maintenance of chromosomes element 4 homolog A
8	9606.ENSP00000358212	0.640	Uncharacterized protein C10orf82
9	9606.ENSP00000400258	0.623	Disks large-associated protein 2
10	9606.ENSP00000363545	0.619	DBF4-type zinc finger-containing protein 2
11	9606.ENSP00000243706	0.602	HAUS augmin-like complex subunit 3
12	9606.ENSP00000479113	0.601	Gamma-aminobutyric acid receptor subunit gamma-3
13	9606.ENSP00000369627	0.563	Protein FAM50B
14	9606.ENSP00000363972	0.547	Zinc finger C4H2 domain-containing protein
15	9606.ENSP00000355388	0.530	M-phase phosphoprotein 8
16	9606.ENSP00000398516	0.522	Lethal(3)malignant brain tumor-like protein 1
17	9606.ENSP00000301698	0.520	Proline-rich protein 25
18	9606.ENSP00000398930	0.513	Epsilon-sarcoglycan
19	9606.ENSP00000484105	0.510	DNA primase large subunit
20	9606.ENSP00000349689	0.509	Palmitoyltransferase ZDHHC9

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:1901363	0.995	heterocyclic compound binding
GO:0097159	0.995	organic cyclic compound binding
GO:1990837	0.990	sequence-specific double-stranded DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.999	regulation of biological process
GO:0050794	0.993	regulation of cellular process
GO:0019222	0.876	regulation of metabolic process
GO:0060255	0.862	regulation of macromolecule metabolic process
GO:0009987	0.831	cellular process
GO:0051171	0.658	regulation of nitrogen compound metabolic process
GO:0080090	0.648	regulation of primary metabolic process
GO:0051252	0.577	regulation of RNA metabolic process
GO:0008152	0.573	metabolic process
GO:0048518	0.510	positive regulation of biological process
GO:0071704	0.502	organic substance metabolic process
GO:0048519	0.457	negative regulation of biological process
GO:0048523	0.453	negative regulation of cellular process
GO:0010468	0.448	regulation of gene expression
GO:0044238	0.441	primary metabolic process
GO:0009889	0.395	regulation of biosynthetic process
GO:2001141	0.388	regulation of RNA biosynthetic process
GO:0048522	0.338	positive regulation of cellular process
GO:0006355	0.325	regulation of DNA-templated transcription

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0070013	0.996	intracellular organelle lumen
GO:0005654	0.986	nucleoplasm
GO:0032991	0.943	protein-containing complex
GO:0005737	0.862	cytoplasm
GO:0043232	0.716	intracellular non-membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]