StarFunc result for job id Q96M02

User Input

>input (699 residues)
MLKLSGEGLRDSYHSRRDQIALKNLQSDVTEAKSDFTKETLASQNTKMISSIVISQMIDE
NKSRENRASLPLPCAIAQSRAHHAKQSLANRSGVNIHRAFALLPGRLGIPAPSDERGPEA
ELPPKEERPCGGPRRGFASITITARRVGPPARALVWGTAGDSLCPKCRAEDTLFQAPPAL
ANGAHPGRHQRSFACTEFSRNSSVVRLKVPEAHTGLCERRKYWVTHADDKETSFSPDTPL
SGKSPLVFSSCVHLRVSQQCPDSIYYVDKSLSVPIEPPQIASPKMHRSVLSLNLNCSSHR
LTADGVDGLVNREPISEALKQELLEGDQDLVGQRWNPGLQESHLKETPSLRRVHLGTGAC
PWSGSFPLENTELANVGANQVTVRKGEKDHTTHCHASDHANQLSIHIPGWSYRAVHTKVF
SGSSKRQQGEVCMTVSAPPVEQKPTRHFLPIGDSSPSDDCLSRDLSEPTERRHQSFLKPR
ILFPGFLCPLQDVCASLQEDNGVQIESKFPKGDYTCCDLVVKIKECKKSEDPTTPEPSPA
APSPAPRDGAGSPGLSEDCSESQQTPARSLTLQEALEVRKPQFISRSQERLKKLEHMVQQ
RKAQRKEDLRQKQSLLPIRTSKKQFTIPHPLSDNLFKPKERCISEKEMHMRSKRIYDNLP
EVKKKKEEQRKRVILQSNRLRAEVFKKQLLDQLLQRNAV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:S4R3N7	0.144	0.131	2.149E-83	796	0.993	0.872	S4R3N7.pdb.gz	S4R3N7_HUMAN Chromosome 10 open reading frame 90 OS=Homo sapiens OX=9606 GN=C10orf90 PE=1 SV=3
2	AFDB:F1QF92	0.087	0.038	2.192E-3	2105	0.195	0.065	F1QF92.pdb.gz	F1QF92_DANRE ALMS1 centrosome and basal body-associated protein OS=Danio rerio OX=7955 GN=alms1 PE=4 SV=1
3	AFDB:P0CY24	0.057	0.036	2.847E-2	1228	0.182	0.103	P0CY24.pdb.gz	STE20_CANAL Serine/threonine-protein kinase CST20 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=CST20 PE=3 SV=1
4	AFDB:Q4VXL8	0.062	0.045	1.133E-1	1038	0.162	0.109	Q4VXL8.pdb.gz	Q4VXL8_HUMAN Transforming acidic coiled-coil containing protein 2 OS=Homo sapiens OX=9606 GN=TACC2 PE=1 SV=1
5	AFDB:M9NE38	0.061	0.029	1.680E-1	1912	0.150	0.055	M9NE38.pdb.gz	JV_DROME Protein javelin OS=Drosophila melanogaster OX=7227 GN=jv PE=4 SV=1
6	AFDB:Q6XK20	0.070	0.049	1.795E-1	1102	0.132	0.083	Q6XK20.pdb.gz	Q6XK20_DROME Bitesize isoform 1 OS=Drosophila melanogaster OX=7227 GN=btsz PE=2 SV=1
7	AFDB:Q96EV2	0.063	0.044	2.843E-1	1170	0.159	0.095	Q96EV2.pdb.gz	RBM33_HUMAN RNA-binding protein 33 OS=Homo sapiens OX=9606 GN=RBM33 PE=1 SV=3
8	AFDB:Q86BM5	0.058	0.050	3.243E-1	837	0.155	0.129	Q86BM5.pdb.gz	Q86BM5_DROME A kinase anchor protein 200, isoform D OS=Drosophila melanogaster OX=7227 GN=Akap200 PE=1 SV=1
9	AFDB:Q8L7W3	0.063	0.053	3.950E-1	878	0.153	0.122	Q8L7W3.pdb.gz	Q8L7W3_ARATH At2g29210/F16P2.41 OS=Arabidopsis thaliana OX=3702 GN=At2g29210 PE=1 SV=1
10	AFDB:G5EEK3	0.060	0.050	4.219E-1	922	0.156	0.118	G5EEK3.pdb.gz	NOCA1_CAEEL Non-centrosomal microtubule array protein 1 OS=Caenorhabditis elegans OX=6239 GN=noca-1 PE=2 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0A0MSX2	0.0	1365	662	0.947	1.000	A0A0A0MSX2_HUMAN Chromosome 10 open reading frame 90 (Fragment) OS=Homo sapiens OX=9606 GN=C10orf90 PE=1 SV=1
2	D2J0Y4	0.0	784	644	0.619	0.672	CJ090_MOUSE (E2-independent) E3 ubiquitin-conjugating enzyme FATS OS=Mus musculus OX=10090 GN=D7Ertd443e PE=1 SV=1
3	Q5T025	0.0	1319	660	0.916	0.970	Q5T025_HUMAN Chromosome 10 open reading frame 90 OS=Homo sapiens OX=9606 GN=C10orf90 PE=1 SV=2
4	Q96M02	0.0	1437	699	1.000	1.000	CJ090_HUMAN (E2-independent) E3 ubiquitin-conjugating enzyme FATS OS=Homo sapiens OX=9606 GN=C10orf90 PE=2 SV=2
5	S4R3N7	0.0	1429	796	0.993	0.872	S4R3N7_HUMAN Chromosome 10 open reading frame 90 OS=Homo sapiens OX=9606 GN=C10orf90 PE=1 SV=3
6	Q8TCU4	4.19e-19	95.1	4168	0.082	0.014	ALMS1_HUMAN Centrosome-associated protein ALMS1 OS=Homo sapiens OX=9606 GN=ALMS1 PE=1 SV=4
7	F1QF92	6.91e-12	71.6	2105	0.073	0.024	F1QF92_DANRE ALMS1 centrosome and basal body-associated protein OS=Danio rerio OX=7955 GN=alms1 PE=4 SV=1
8	A0A8I6G4M9	3.52e-11	69.3	3529	0.083	0.016	A0A8I6G4M9_RAT ALMS1, centrosome and basal body associated protein OS=Rattus norvegicus OX=10116 GN=Alms1 PE=4 SV=1
9	F1LVG9	3.90e-11	69.3	3565	0.083	0.016	F1LVG9_RAT ALMS1, centrosome and basal body associated protein OS=Rattus norvegicus OX=10116 GN=Alms1 PE=1 SV=3
10	A0A8I5ZSK7	4.14e-11	69.3	3600	0.083	0.016	A0A8I5ZSK7_RAT ALMS1, centrosome and basal body associated protein OS=Rattus norvegicus OX=10116 GN=Alms1 PE=4 SV=1
11	Q8K4E0	5.54e-10	65.5	3251	0.080	0.017	ALMS1_MOUSE Centrosome-associated protein ALMS1 OS=Mus musculus OX=10090 GN=Alms1 PE=1 SV=2
12	Q9C0D2	1.08e-05	51.6	2601	0.067	0.018	CE295_HUMAN Centrosomal protein of 295 kDa OS=Homo sapiens OX=9606 GN=CEP295 PE=1 SV=4
13	A0A8I5XVN1	4.21e-05	49.7	3586	0.056	0.011	A0A8I5XVN1_RAT ALMS1, centrosome and basal body associated protein OS=Rattus norvegicus OX=10116 GN=Alms1 PE=4 SV=1
14	Q5BI31	0.008	42.4	1322	0.056	0.030	ALMS1_DROME Centrosome-associated protein Alms1a OS=Drosophila melanogaster OX=7227 GN=Alms1a PE=1 SV=1
15	P18848	0.94	35.0	351	0.050	0.100	ATF4_HUMAN Cyclic AMP-dependent transcription factor ATF-4 OS=Homo sapiens OX=9606 GN=ATF4 PE=1 SV=3
16	D3ZD32	1.1	35.0	1948	0.063	0.023	CHD5_RAT Chromodomain-helicase-DNA-binding protein 5 OS=Rattus norvegicus OX=10116 GN=Chd5 PE=1 SV=1
17	M9PJ28	1.2	35.0	987	0.053	0.037	M9PJ28_DROME Uncharacterized protein, isoform B OS=Drosophila melanogaster OX=7227 GN=Alms1b PE=4 SV=1
18	Q8IDX6	3.2	33.9	3130	0.056	0.012	RH2A_PLAF7 Reticulocyte-binding protein homolog 2a OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=RH2a PE=1 SV=1
19	G3V9H8	3.9	33.1	1115	0.052	0.032	RET_RAT Proto-oncogene tyrosine-protein kinase receptor Ret OS=Rattus norvegicus OX=10116 GN=Ret PE=1 SV=1
20	Q66X05	8.8	32.0	959	0.036	0.026	NAL4F_MOUSE NACHT, LRR and PYD domains-containing protein 4F OS=Mus musculus OX=10090 GN=Nlrp4f PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF15309 ALMS_motif	6.8e-47	170.6	ALMS motif
2	PF17730 Centro_C10orf90	4e-268	902.0	Centrosomal C10orf90

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000284694

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000280333	0.764	Dedicator of cytokinesis protein 1
2	9606.ENSP00000269305	0.550	Cellular tumor antigen p53
3	9606.ENSP00000353210	0.528	ADP-ribosylation factor-like protein 9

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0019787	1.000	ubiquitin-like protein transferase activity
GO:0042826	0.966	histone deacetylase binding
GO:0004842	0.958	ubiquitin-protein transferase activity
GO:0061659	0.926	ubiquitin-like protein ligase activity
GO:0061630	0.660	ubiquitin protein ligase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.985	cellular process
GO:0010564	0.981	regulation of cell cycle process
GO:0007165	0.977	signal transduction
GO:0006974	0.945	cellular response to DNA damage stimulus
GO:0035556	0.863	intracellular signal transduction
GO:1901988	0.838	negative regulation of cell cycle phase transition
GO:0051128	0.771	regulation of cellular component organization
GO:0007346	0.739	regulation of mitotic cell cycle
GO:0042770	0.686	signal transduction in response to DNA damage
GO:1901991	0.650	negative regulation of mitotic cell cycle phase transition
GO:0000075	0.650	cell cycle checkpoint signaling
GO:0009411	0.628	response to UV
GO:1902749	0.589	regulation of cell cycle G2/M phase transition
GO:0044773	0.588	mitotic DNA damage checkpoint signaling
GO:0045926	0.574	negative regulation of growth
GO:0001558	0.552	regulation of cell growth
GO:0070647	0.543	protein modification by small protein conjugation or removal
GO:0031647	0.542	regulation of protein stability
GO:0016567	0.520	protein ubiquitination
GO:0030308	0.518	negative regulation of cell growth
GO:0050821	0.494	protein stabilization
GO:0010389	0.480	regulation of G2/M transition of mitotic cell cycle
GO:1902750	0.476	negative regulation of cell cycle G2/M phase transition
GO:0010972	0.472	negative regulation of G2/M transition of mitotic cell cycle
GO:0010212	0.471	response to ionizing radiation
GO:0000209	0.456	protein polyubiquitination
GO:0071840	0.440	cellular component organization or biogenesis
GO:0048518	0.429	positive regulation of biological process
GO:0016043	0.415	cellular component organization
GO:0048522	0.379	positive regulation of cellular process
GO:0007095	0.333	mitotic G2 DNA damage checkpoint signaling

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0005829	1.000	cytosol
GO:0005654	1.000	nucleoplasm
GO:0043232	0.845	intracellular non-membrane-bounded organelle
GO:0005815	0.456	microtubule organizing center
GO:0005813	0.370	centrosome

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.-.-.-	1.000	Transferases.

[back to server]