StarFunc result for job id Q96M27

User Input

>input (445 residues)
MMEESGIETTPPGTPPPNPAGLAATAMSSTPVPLAATSSFSSPNVSSMESFPPLAYSTPQ
PPLPPVRPSAPLPFVPPPAVPSVPPLVTSMPPPVSPSTAAAFGNPPVSHFPPSTSAPNTL
LPAPPSGPPISGFSVGSTYDITRGHAGRAPQTPLMPSFSAPSGTGLLPTPITQQASLTSL
AQGTGTTSAITFPEEQEDPRITRGQDEASAGGIWGFIKGVAGNPMVKSVLDKTKHSVESM
ITTLDPGMAPYIKSGGELDIVVTSNKEVKVAAVRDAFQEVFGLAVVVGEAGQSNIAPQPV
GYAAGLKGAQERIDSLRRTGVIHEKQTAVSVENFIAELLPDKWFDIGCLVVEDPVHGIHL
ETFTQATPVPLEFVQQAQSLTPQDYNLRWSGLLVTVGEVLEKSLLNVSRTDWHMAFTGMS
RRQMIYSAARAIAGMYKQRLPPRTV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q96M27	1.000	1.000	1.601E-70	445	1.000	1.000	Q96M27.pdb.gz	PRRC1_HUMAN Protein PRRC1 OS=Homo sapiens OX=9606 GN=PRRC1 PE=1 SV=1
2	PDB:1u5wC	0.326	0.788	2.174E-9	174	0.081	0.207	1u5wC.pdb.gz
3	PDB:4jhcA	0.172	0.349	2.997E-3	192	0.031	0.073	4jhcA.pdb.gz
4	PDB:4p0eA	0.173	0.361	3.805E-3	189	0.020	0.048	4p0eA.pdb.gz
5	PDB:2carA	0.214	0.417	6.508E-3	196	0.045	0.102	2carA.pdb.gz
6	PDB:2pyuA	0.179	0.361	1.049E-2	208	0.038	0.082	2pyuA.pdb.gz	Molecular basis of the antimutagenic activity of the house-cleaning inosine triphosphate pyrophosphatase RdgB from Escherichia coli.
7	PDB:3bxoA	0.111	0.177	1.690E-2	236	0.045	0.085	3bxoA.pdb.gz	Three-Dimensional Structure of DesVI from Streptomyces venezuelae: A Sugar N,N-Dimethyltransferase Required for dTDP-Desosamine Biosynthesis.
8	PDB:2hqsA	0.129	0.137	4.135E-2	412	0.034	0.036	2hqsA.pdb.gz
9	PDB:2xokG	0.104	0.146	4.135E-2	265	0.061	0.102	2xokG.pdb.gz	Molecular architecture of the rotary motor in ATP synthase.
10	PDB:4oqdC	0.108	0.168	4.389E-2	241	0.049	0.091	4oqdC.pdb.gz	Production of a novel N-monomethylated dideoxysugar.
11	PDB:2mjpA	0.207	0.434	5.572E-2	184	0.036	0.087	2mjpA.pdb.gz	Structure-based identification of a novel NTPase from Methanococcus jannaschii.
12	AFDB:Q0WR25	0.141	0.112	4.018E-1	634	0.164	0.115	Q0WR25.pdb.gz	Q0WR25_ARATH YTH domain-containing family protein OS=Arabidopsis thaliana OX=3702 GN=ECT5 PE=1 SV=1
13	AFDB:O35817	0.107	0.099	6.100E-1	502	0.133	0.118	O35817.pdb.gz	AKA14_RAT A-kinase anchor protein 14 OS=Rattus norvegicus OX=10116 GN=Akap14 PE=2 SV=1
14	AFDB:Q9QY02	0.136	0.094	7.744E-1	738	0.146	0.088	Q9QY02.pdb.gz	YTDC1_RAT YTH domain-containing protein 1 OS=Rattus norvegicus OX=10116 GN=Ythdc1 PE=1 SV=2
15	AFDB:F4KDJ9	0.132	0.118	1.108	528	0.157	0.133	F4KDJ9.pdb.gz	F4KDJ9_ARATH YTH domain-containing family protein OS=Arabidopsis thaliana OX=3702 GN=ECT10 PE=1 SV=1
16	AFDB:P27692	0.094	0.056	2.405	1063	0.115	0.048	P27692.pdb.gz	SPT5_YEAST Transcription elongation factor SPT5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SPT5 PE=1 SV=1
17	AFDB:Q90ZB2	0.068	0.089	2.710	316	0.126	0.177	Q90ZB2.pdb.gz	Q90ZB2_DANRE Gastrulation brain homeobox 1 OS=Danio rerio OX=7955 GN=wu:fj77a06 PE=2 SV=1
18	AFDB:A0A1W2PRB5	0.065	0.034	3.440	1041	0.106	0.045	A0A1W2PRB5.pdb.gz	A0A1W2PRB5_HUMAN KAT8 regulatory NSL complex subunit 1 OS=Homo sapiens OX=9606 GN=KANSL1 PE=1 SV=1
19	AFDB:A0A140VJR0	0.059	0.038	4.114	809	0.083	0.046	A0A140VJR0.pdb.gz	A0A140VJR0_HUMAN Phosphodiesterase OS=Homo sapiens OX=9606 GN=PDE4D PE=2 SV=1
20	AFDB:G0SDQ4	0.077	0.036	4.920	1169	0.117	0.044	G0SDQ4.pdb.gz	NUP85_CHATD Nucleoporin NUP85 OS=Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) OX=759272 GN=NUP85 PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q5XJA3	0.0	525	435	0.667	0.683	PRRC1_DANRE Protein PRRC1 OS=Danio rerio OX=7955 GN=prrc1 PE=2 SV=2
2	Q96M27	0.0	887	445	1.000	1.000	PRRC1_HUMAN Protein PRRC1 OS=Homo sapiens OX=9606 GN=PRRC1 PE=1 SV=1
3	Q17636	1.46e-07	55.8	418	0.088	0.093	Q17636_CAEEL Protein TIC OS=Caenorhabditis elegans OX=6239 GN=C04G6.4 PE=1 SV=2
4	M9PC48	0.003	42.7	18095	0.099	0.002	M9PC48_DROME Dumpy, isoform Y OS=Drosophila melanogaster OX=7227 GN=dpy PE=4 SV=1
5	M9PCJ6	0.003	42.7	18641	0.099	0.002	M9PCJ6_DROME Dumpy, isoform S OS=Drosophila melanogaster OX=7227 GN=dpy PE=4 SV=1
6	Q18221	0.13	37.4	1507	0.072	0.021	SET2_CAEEL Histone-lysine N-methyltransferase set-2 OS=Caenorhabditis elegans OX=6239 GN=set-2 PE=1 SV=2
7	Q9Z0R4	3.3	32.7	1714	0.070	0.018	ITSN1_MOUSE Intersectin-1 OS=Mus musculus OX=10090 GN=Itsn1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01931 NTPase_I-T	6.2e-07	40.9	Protein of unknown function DUF84

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9601.ENSPPYP00000017598

Rank	PPI partner	STRING score	Description
1	9601.ENSPPYP00000002427	0.659	ADP-sugar pyrophosphatase

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0065007	0.976	biological regulation
GO:0019222	0.966	regulation of metabolic process
GO:0031323	0.963	regulation of cellular metabolic process
GO:0060255	0.961	regulation of macromolecule metabolic process
GO:0080090	0.960	regulation of primary metabolic process
GO:0051171	0.960	regulation of nitrogen compound metabolic process
GO:0048522	0.952	positive regulation of cellular process
GO:0009893	0.947	positive regulation of metabolic process
GO:0031325	0.942	positive regulation of cellular metabolic process
GO:0051246	0.937	regulation of protein metabolic process
GO:0010604	0.937	positive regulation of macromolecule metabolic process
GO:0051347	0.918	positive regulation of transferase activity
GO:0051173	0.910	positive regulation of nitrogen compound metabolic process
GO:0033674	0.905	positive regulation of kinase activity
GO:0031401	0.887	positive regulation of protein modification process
GO:0001932	0.887	regulation of protein phosphorylation
GO:0045860	0.877	positive regulation of protein kinase activity
GO:0035282	0.860	segmentation
GO:0042592	0.836	homeostatic process
GO:0009790	0.830	embryo development
GO:0048871	0.823	multicellular organismal-level homeostasis
GO:0009952	0.823	anterior/posterior pattern specification
GO:0032147	0.821	activation of protein kinase activity
GO:0061053	0.820	somite development
GO:0007379	0.820	segment specification
GO:0001894	0.800	tissue homeostasis
GO:0001756	0.799	somitogenesis
GO:0009987	0.725	cellular process
GO:0010669	0.646	epithelial structure maintenance
GO:0009880	0.435	embryonic pattern specification
GO:0008152	0.425	metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005794	0.999	Golgi apparatus
GO:0005634	0.765	nucleus
GO:0031981	0.436	nuclear lumen
GO:0016020	0.369	membrane
GO:0031090	0.335	organelle membrane
GO:0043232	0.324	intracellular non-membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]