StarFunc result for job id Q96M29

User Input

>input (485 residues)
MEFLGTTQTASYCGPKKCCGLTSLPAVQAPVIQECYQPYYLPGYRYLNSWRPSLFYKIAN
VQTCPDESTSTLRPPTILPTLRSALFSRYSPHDWDQSNQLQVRGAEASRLWASRLTDDSM
RLLQDKDQLTHQMQEGTCRNLGQRLSDIGFWKSELSYELDRLLTENQNLETVKRRLECAA
NEVNCPLQVALECLYHREKRIGIDLVHDNVEKNLIREVDLLKCCQEQMRKLAQRIDIQMR
DNRDAQHVLERDLEDKSSAQCIDEKCFNLRNTSDCISFFHGMEKIDGTISVPETWAKFSN
DNIKHSQNMRANSIQLREEAEHLFETLSDQMWRQFTDTNLAFNARISEVTDVKNKLQTQL
AKTLQEIFQAENTIMLLERSIMAKEGPLKVAQTRLECRTRRPNMELCRDIPQLKLVNEVF
TIDDTLQTLKLRLRETQDTLQLLVMTKCRLEHELAIKANTLCIDKEKCMGMRKTFPCTPR
LVGHT

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q96M29	1.000	1.000	2.958E-59	485	1.000	1.000	Q96M29.pdb.gz	TEKT5_HUMAN Tektin-5 OS=Homo sapiens OX=9606 GN=TEKT5 PE=1 SV=1
2	AFDB:G5E8A8	0.894	0.782	1.194E-50	557	0.831	0.724	G5E8A8.pdb.gz	TEKT5_MOUSE Tektin-5 OS=Mus musculus OX=10090 GN=Tekt5 PE=1 SV=1
3	AFDB:E7F7G5	0.819	0.814	6.416E-37	488	0.522	0.518	E7F7G5.pdb.gz	E7F7G5_DANRE Tektin OS=Danio rerio OX=7955 GN=tekt3 PE=3 SV=1
4	AFDB:A6H782	0.823	0.814	1.737E-36	490	0.522	0.516	A6H782.pdb.gz	TEKT3_BOVIN Tektin-3 OS=Bos taurus OX=9913 GN=TEKT3 PE=1 SV=1
5	AFDB:Q4V8G8	0.816	0.808	5.392E-35	490	0.482	0.478	Q4V8G8.pdb.gz	TEKT3_RAT Tektin-3 OS=Rattus norvegicus OX=10116 GN=Tekt3 PE=1 SV=1
6	PDB:7rroF1	0.759	0.869	8.334E-28	421	0.458	0.527	7rroF1.pdb.gz	De novo identification of mammalian ciliary motility proteins using cryo-EM.
7	AFDB:Q2TA38	0.797	0.863	1.425E-24	447	0.313	0.340	Q2TA38.pdb.gz	TEKT4_BOVIN Tektin-4 OS=Bos taurus OX=9913 GN=TEKT4 PE=1 SV=1
8	AFDB:Q9DAJ2	0.765	0.882	7.012E-24	418	0.307	0.356	Q9DAJ2.pdb.gz	TEKT1_MOUSE Tektin-1 OS=Mus musculus OX=10090 GN=Tekt1 PE=1 SV=1
9	AFDB:Q8WW24	0.799	0.888	1.212E-23	435	0.299	0.333	Q8WW24.pdb.gz	TEKT4_HUMAN Tektin-4 OS=Homo sapiens OX=9606 GN=TEKT4 PE=1 SV=1
10	AFDB:Q149S1	0.798	0.863	1.718E-23	447	0.303	0.329	Q149S1.pdb.gz	TEKT4_MOUSE Tektin-4 OS=Mus musculus OX=10090 GN=Tekt4 PE=1 SV=2
11	AFDB:Q969V4	0.734	0.844	6.926E-23	418	0.293	0.340	Q969V4.pdb.gz	TEKT1_HUMAN Tektin-1 OS=Homo sapiens OX=9606 GN=TEKT1 PE=1 SV=1
12	PDB:7rroD1	0.771	0.874	5.462E-22	425	0.293	0.334	7rroD1.pdb.gz	De novo identification of mammalian ciliary motility proteins using cryo-EM.
13	PDB:7ungD2	0.770	0.930	2.314E-21	398	0.282	0.344	7ungD2.pdb.gz	SPACA9 is a lumenal protein of human ciliary singlet and doublet microtubules.
14	PDB:7rroA1	0.756	0.918	3.279E-21	396	0.287	0.351	7rroA1.pdb.gz	De novo identification of mammalian ciliary motility proteins using cryo-EM.
15	PDB:7ungA1	0.759	0.934	5.133E-21	391	0.293	0.363	7ungA1.pdb.gz	SPACA9 is a lumenal protein of human ciliary singlet and doublet microtubules.
16	PDB:7ungC1	0.656	0.936	2.069E-20	336	0.365	0.527	7ungC1.pdb.gz	SPACA9 is a lumenal protein of human ciliary singlet and doublet microtubules.
17	PDB:7ungD3	0.625	0.943	3.670E-18	317	0.247	0.379	7ungD3.pdb.gz	SPACA9 is a lumenal protein of human ciliary singlet and doublet microtubules.
18	PDB:7rroD6	0.627	0.940	3.281E-17	319	0.254	0.386	7rroD6.pdb.gz	De novo identification of mammalian ciliary motility proteins using cryo-EM.
19	PDB:7rroB1	0.749	0.866	1.461E-16	416	0.245	0.286	7rroB1.pdb.gz	De novo identification of mammalian ciliary motility proteins using cryo-EM.
20	PDB:7ungA3	0.656	0.944	9.107E-15	333	0.229	0.333	7ungA3.pdb.gz	SPACA9 is a lumenal protein of human ciliary singlet and doublet microtubules.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	G5E8A8	0.0	848	557	0.831	0.724	TEKT5_MOUSE Tektin-5 OS=Mus musculus OX=10090 GN=Tekt5 PE=1 SV=1
2	Q96M29	0.0	1006	485	1.000	1.000	TEKT5_HUMAN Tektin-5 OS=Homo sapiens OX=9606 GN=TEKT5 PE=1 SV=1
3	E7F7G5	1.79e-171	493	488	0.522	0.518	E7F7G5_DANRE Tektin OS=Danio rerio OX=7955 GN=tekt3 PE=3 SV=1
4	A6H782	4.09e-170	490	490	0.524	0.518	TEKT3_BOVIN Tektin-3 OS=Bos taurus OX=9913 GN=TEKT3 PE=1 SV=1
5	Q6X6Z7	2.54e-165	478	490	0.507	0.502	TEKT3_MOUSE Tektin-3 OS=Mus musculus OX=10090 GN=Tekt3 PE=1 SV=1
6	Q9BXF9	1.18e-160	466	490	0.507	0.502	TEKT3_HUMAN Tektin-3 OS=Homo sapiens OX=9606 GN=TEKT3 PE=1 SV=1
7	Q4V8G8	3.36e-160	464	490	0.505	0.500	TEKT3_RAT Tektin-3 OS=Rattus norvegicus OX=10116 GN=Tekt3 PE=1 SV=1
8	Q9DAJ2	3.55e-81	259	418	0.309	0.359	TEKT1_MOUSE Tektin-1 OS=Mus musculus OX=10090 GN=Tekt1 PE=1 SV=1
9	Q969V4	3.20e-77	249	418	0.293	0.340	TEKT1_HUMAN Tektin-1 OS=Homo sapiens OX=9606 GN=TEKT1 PE=1 SV=1
10	Q32KZ9	1.59e-75	245	418	0.301	0.349	TEKT1_BOVIN Tektin-1 OS=Bos taurus OX=9913 GN=TEKT1 PE=1 SV=1
11	Q2TA38	1.38e-71	236	447	0.293	0.318	TEKT4_BOVIN Tektin-4 OS=Bos taurus OX=9913 GN=TEKT4 PE=1 SV=1
12	Q149S1	7.20e-70	231	447	0.291	0.315	TEKT4_MOUSE Tektin-4 OS=Mus musculus OX=10090 GN=Tekt4 PE=1 SV=2
13	A0A0R4IRF0	4.08e-68	225	402	0.282	0.341	A0A0R4IRF0_DANRE Tektin OS=Danio rerio OX=7955 GN=zgc:101797 PE=1 SV=1
14	Q5U3Q0	2.90e-67	223	398	0.282	0.344	Q5U3Q0_DANRE Tektin OS=Danio rerio OX=7955 GN=zgc:101797 PE=1 SV=1
15	Q8WW24	4.21e-63	213	435	0.285	0.317	TEKT4_HUMAN Tektin-4 OS=Homo sapiens OX=9606 GN=TEKT4 PE=1 SV=1
16	Q2T9Q6	1.20e-37	145	430	0.249	0.281	TEKT2_BOVIN Tektin-2 OS=Bos taurus OX=9913 GN=TEKT2 PE=1 SV=1
17	Q9UIF3	5.64e-36	140	430	0.247	0.279	TEKT2_HUMAN Tektin-2 OS=Homo sapiens OX=9606 GN=TEKT2 PE=1 SV=1
18	Q922G7	3.01e-33	132	430	0.272	0.307	TEKT2_MOUSE Tektin-2 OS=Mus musculus OX=10090 GN=Tekt2 PE=1 SV=1
19	O13127	1.6	33.5	423	0.099	0.113	FLOT1_CARAU Flotillin-1 OS=Carassius auratus OX=7957 GN=flot1 PE=1 SV=1
20	P24391	1.9	33.1	349	0.033	0.046	TOM40_NEUCR Mitochondrial import receptor subunit tom40 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) OX=367110 GN=tom40 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF18890 FANCL_d2	2.7e+02	13.5	FANCL UBC-like domain 2
2	PF03148 Tektin	5.1e-135	461.8	Tektin family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000283025

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000288912	0.680	Cilia- and flagella-associated protein 251
2	9606.ENSP00000329860	0.642	Coiled-coil domain containing 172
3	9606.ENSP00000371586	0.628	Phosphatidylserine decarboxylase proenzyme, mitochondrial
4	9606.ENSP00000377428	0.552	Cilia and flagella associated protein 44
5	9606.ENSP00000440982	0.546	Ras GTPase-activating protein 4B
6	9606.ENSP00000353942	0.539	Dynein regulatory complex subunit 7
7	9606.ENSP00000387078	0.527	WD repeat, sterile alpha motif and U-box domain containing 1
8	9606.ENSP00000360107	0.523	EF-hand domain-containing protein 1
9	9606.ENSP00000404232	0.522	EF-hand domain-containing family member C2
10	9606.ENSP00000313600	0.517	Probable phospholipid-transporting ATPase VB

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.997	cellular process
GO:0120036	0.993	plasma membrane bounded cell projection organization
GO:0022414	0.982	reproductive process
GO:0001539	0.982	cilium or flagellum-dependent cell motility
GO:0044782	0.975	cilium organization
GO:0120031	0.975	plasma membrane bounded cell projection assembly
GO:0060271	0.972	cilium assembly
GO:0060285	0.963	cilium-dependent cell motility
GO:0030317	0.935	flagellated sperm motility
GO:0032501	0.877	multicellular organismal process
GO:0048609	0.513	multicellular organismal reproductive process
GO:0065007	0.384	biological regulation
GO:0044706	0.301	multi-multicellular organism process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043227	0.999	membrane-bounded organelle
GO:0043229	0.999	intracellular organelle
GO:0043231	0.982	intracellular membrane-bounded organelle
GO:0005737	0.965	cytoplasm
GO:0005634	0.887	nucleus
GO:0005929	0.838	cilium
GO:0031514	0.739	motile cilium
GO:0097729	0.405	9+2 motile cilium
GO:0036126	0.400	sperm flagellum
GO:0005856	0.311	cytoskeleton

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]