StarFunc result for job id Q96M32

User Input

>input (723 residues)
MAEEEETAALTEKVIRTQRVFINLLDSYSSGNIGKFLSNCVVGASLEEITEEEEEEDENK
SAMLEASSTKVKEGTFQIVGTLSKPDSPRPDFAVETYSAISREDLLMRLLECDVIIYNIT
ESSQQMEEAIWAVSALSEEVSHFEKRKLFILLSTVMTWARSKALDPEDSEVPFTEEDYRR
RKSHPNFLDHINAEKMVLKFGKKARKFAAYVVAAGLQYGAEGGMLHTFFKMAWLGEIPAL
PVFGDGTNVIPTIHVLDLAGVIQNVIDHVPKPHYLVAVDESVHTLEDIVKCISKNTGPGK
IQKIPRENAYLTKDLTQDCLDHLLVNLRMEALFVKENFNIRWAAQTGFVENINTILKEYK
QSRGLMPIKICILGPPAVGKSSIAKELANYYKLHHIQLKDVISEAIAKLEAIVAPNDVGE
GEEEVEEEEEEENVEDAQELLDGIKESMEQNAGQLDDQYIIRFMKEKLKSMPCRNQGYIL
DGFPKTYDQAKDLFNQEDEEEEDDVRGRMFPFDKLIIPEFVCALDASDEFLKERVINLPE
SIVAGTHYSQDRFLRALSNYRDINIDDETVFNYFDELEIHPIHIDVGKLEDAQNRLAIKQ
LIKEIGEPRNYGLTDEEKAEEERKAAEERLAREAAEEAEREHQEAVEMAEKIARWEEWNK
RLEEVKREERELLEAQSIPLRNYLMTYVMPTLIQGLNECCNVRPEDPVDFLAEYLFKNNP
EAQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q96M32	1.000	1.000	0.000	723	1.000	1.000	Q96M32.pdb.gz	KAD7_HUMAN Adenylate kinase 7 OS=Homo sapiens OX=9606 GN=AK7 PE=1 SV=3
2	AFDB:Q9D2H2	0.809	0.948	4.289E-102	614	0.741	0.873	Q9D2H2.pdb.gz	KAD7_MOUSE Adenylate kinase 7 OS=Mus musculus OX=10090 GN=Ak7 PE=1 SV=1
3	PDB:4b4oA	0.309	0.688	2.397E-11	295	0.066	0.163	4b4oA.pdb.gz	Crystal Structure of Human Epimerase Family Protein Sdr39U1 (Isoform2) with Nadph
4	AFDB:Q20697	0.334	0.644	3.939E-11	342	0.072	0.152	Q20697.pdb.gz	Q20697_CAEEL NAD(P)-binding domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=bus-5 PE=1 SV=1
5	AFDB:Q9SYM5	0.333	0.357	4.411E-11	669	0.083	0.090	Q9SYM5.pdb.gz	RHM1_ARATH Trifunctional UDP-glucose 4,6-dehydratase/UDP-4-keto-6-deoxy-D-glucose 3,5-epimerase/UDP-4-keto-L-rhamnose-reductase RHM1 OS=Arabidopsis thaliana OX=3702 GN=RHM1 PE=1 SV=1
6	AFDB:Q9NRG7	0.306	0.683	1.091E-10	293	0.068	0.167	Q9NRG7.pdb.gz	D39U1_HUMAN Epimerase family protein SDR39U1 OS=Homo sapiens OX=9606 GN=SDR39U1 PE=1 SV=3
7	AFDB:P96816	0.344	0.677	1.368E-10	340	0.071	0.150	P96816.pdb.gz	P96816_MYCTU Possible oxidoreductase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=Rv0139 PE=1 SV=1
8	AFDB:A0A2R9YJL3	0.237	0.102	1.532E-10	1762	0.115	0.047	A0A2R9YJL3.pdb.gz	A0A2R9YJL3_DANRE Cilia- and flagella-associated protein 206 OS=Danio rerio OX=7955 GN=si:ch211-199m3.4 PE=3 SV=1
9	AFDB:Q72EM3	0.326	0.697	1.532E-10	312	0.077	0.179	Q72EM3.pdb.gz	Q72EM3_DESVH NAD-dependent epimerase/dehydratase family protein OS=Desulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / NCIMB 8303 / VKM B-1760 / Hildenborough) OX=882 GN=DVU_0554 PE=1 SV=1
10	PDB:1gy8C	0.324	0.589	3.062E-10	370	0.072	0.141	1gy8C.pdb.gz	High-Resolution Crystal Structure of Trypanosoma Brucei Udp-Galactose 4'-Epimerase: A Potential Target for Structure-Based Development of Novel Trypanocides
11	AFDB:Q12177	0.322	0.714	3.791E-10	298	0.075	0.181	Q12177.pdb.gz	YL056_YEAST Uncharacterized protein YLL056C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YLL056C PE=2 SV=1
12	AFDB:Q9SJU9	0.340	0.667	3.791E-10	347	0.062	0.130	Q9SJU9.pdb.gz	GC1_ARATH Epimerase family protein SDR39U1 homolog, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=GC1 PE=2 SV=2
13	PDB:2pk3A	0.325	0.695	4.064E-10	309	0.058	0.136	2pk3A.pdb.gz	The structural basis for catalytic function of GMD and RMD, two closely related enzymes from the GDP-D-rhamnose biosynthesis pathway.
14	PDB:6vo6D	0.315	0.681	8.977E-10	311	0.064	0.148	6vo6D.pdb.gz	Structural Analysis of Cj1427, an Essential NAD-Dependent Dehydrogenase for the Biosynthesis of the Heptose Residues in the Capsular Polysaccharides ofCampylobacter jejuni.
15	PDB:1a9yA	0.334	0.666	1.064E-9	338	0.076	0.163	1a9yA.pdb.gz	Dramatic differences in the binding of UDP-galactose and UDP-glucose to UDP-galactose 4-epimerase from Escherichia coli.
16	PDB:4r1sA	0.314	0.649	1.261E-9	319	0.065	0.147	4r1sA.pdb.gz	Structural Studies of Cinnamoyl-CoA Reductase and Cinnamyl-Alcohol Dehydrogenase, Key Enzymes of Monolignol Biosynthesis.
17	PDB:4r1uB	0.307	0.655	1.581E-9	309	0.064	0.149	4r1uB.pdb.gz
18	PDB:2x6tG	0.302	0.652	1.673E-9	308	0.057	0.133	2x6tG.pdb.gz	The Crystal Structure of the Y140F Mutant of Adp-L-Glycero-D-Manno-Heptose 6-Epimerase Bound to Adp-Beta-D-Mannose Suggests a One Base Mechanism.
19	PDB:4lisA	0.323	0.595	1.874E-9	364	0.073	0.146	4lisA.pdb.gz	Elucidation of Substrate Specificity in Aspergillus nidulans UDP-Galactose-4-Epimerase.
20	PDB:1bsvA	0.294	0.599	2.221E-9	317	0.062	0.142	1bsvA.pdb.gz	GDP-fucose synthetase from Escherichia coli: structure of a unique member of the short-chain dehydrogenase/reductase family that catalyzes two distinct reactions at the same active site.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q96M32	0.0	1484	723	1.000	1.000	KAD7_HUMAN Adenylate kinase 7 OS=Homo sapiens OX=9606 GN=AK7 PE=1 SV=3
2	Q9D2H2	0.0	1080	614	0.741	0.873	KAD7_MOUSE Adenylate kinase 7 OS=Mus musculus OX=10090 GN=Ak7 PE=1 SV=1
3	B8JMZ3	1.77e-08	55.1	106	0.037	0.255	B8JMZ3_DANRE Dpy-30 histone methyltransferase complex regulatory subunit OS=Danio rerio OX=7955 GN=zgc:92638 PE=1 SV=1
4	Q9C005	2.03e-07	51.6	99	0.041	0.303	DPY30_HUMAN Protein dpy-30 homolog OS=Homo sapiens OX=9606 GN=DPY30 PE=1 SV=1
5	Q1L8L9	2.46e-07	54.7	241	0.061	0.183	KAD2_DANRE Adenylate kinase 2, mitochondrial OS=Danio rerio OX=7955 GN=ak2 PE=2 SV=1
6	Q8K3E7	2.94e-07	51.2	99	0.041	0.303	DPY30_RAT Protein dpy-30 homolog OS=Rattus norvegicus OX=10116 GN=Dpy30 PE=1 SV=1
7	P29410	5.78e-07	53.5	239	0.054	0.163	KAD2_RAT Adenylate kinase 2, mitochondrial OS=Rattus norvegicus OX=10116 GN=Ak2 PE=2 SV=2
8	P56597	9.24e-07	52.4	212	0.028	0.094	NDK5_HUMAN Nucleoside diphosphate kinase homolog 5 OS=Homo sapiens OX=9606 GN=NME5 PE=1 SV=1
9	Q99MH5	1.13e-06	52.4	211	0.037	0.128	NDK5_MOUSE Nucleoside diphosphate kinase homolog 5 OS=Mus musculus OX=10090 GN=Nme5 PE=1 SV=2
10	Q5TCS8	2.36e-06	53.9	1911	0.059	0.023	KAD9_HUMAN Adenylate kinase 9 OS=Homo sapiens OX=9606 GN=AK9 PE=1 SV=2
11	Q9FIJ7	2.48e-06	52.0	283	0.068	0.173	KAD2_ARATH Adenylate kinase 2, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=At5g47840 PE=1 SV=1
12	Q9WTP6	2.61e-06	51.6	239	0.051	0.155	KAD2_MOUSE Adenylate kinase 2, mitochondrial OS=Mus musculus OX=10090 GN=Ak2 PE=1 SV=5
13	P07170	3.49e-06	50.8	222	0.046	0.149	KAD2_YEAST Adenylate kinase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ADK1 PE=1 SV=2
14	I1XB05	3.89e-06	51.2	242	0.047	0.140	I1XB05_HELAM Adenylate kinase OS=Helicoverpa armigera OX=29058 GN=AK2 PE=2 SV=1
15	Q38BZ2	7.66e-06	50.1	222	0.046	0.149	Q38BZ2_TRYB2 Adenylate kinase, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.70.5150 PE=3 SV=1
16	P54819	7.93e-06	50.1	239	0.051	0.155	KAD2_HUMAN Adenylate kinase 2, mitochondrial OS=Homo sapiens OX=9606 GN=AK2 PE=1 SV=2
17	P33075	1.13e-05	49.3	220	0.046	0.150	KAD2_SCHPO Adenylate kinase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=adk1 PE=1 SV=1
18	Q5B2V8	1.37e-05	49.7	259	0.046	0.127	KAD2_EMENI Adenylate kinase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=adk1 PE=3 SV=1
19	Q9VZJ1	2.26e-05	45.8	98	0.028	0.204	Q9VZJ1_DROME Dpy-30-like 2, isoform A OS=Drosophila melanogaster OX=7227 GN=Dpy-30L2 PE=2 SV=1
20	Q8VYL1	2.43e-05	50.1	588	0.059	0.073	KAD5_ARATH Adenylate kinase 5, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=At5g35170 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00004 AAA	3.7	19.4	ATPase family associated with various cellular activities (AAA)
2	PF13191 AAA_16	1.1e+02	14.6	AAA ATPase domain
3	PF13207 AAA_17	0.33	22.8	AAA domain
4	PF13238 AAA_18	0.034	26.1	AAA domain
5	PF13479 AAA_24	3.3e+02	12.4	AAA domain
6	PF13521 AAA_28	58	15.4	AAA domain
7	PF00406 ADK	1.2e-07	43.4	Adenylate kinase
8	PF02224 Cytidylate_kin	3.9e+02	12.2	Cytidylate kinase
9	PF05186 Dpy-30	1.1e-16	71.6	Dpy-30 motif
10	PF01370 Epimerase	25	15.8	NAD dependent epimerase/dehydratase family
11	PF17213 Hydin_ADK	16	17.0	Hydin Adenylate kinase-like domain
12	PF08433 KTI12	1.6e+02	13.2	Chromatin associated protein KTI12
13	PF01926 MMR_HSR1	1.5e+02	13.9	50S ribosome-binding GTPase
14	PF02197 RIIa	5.5e+02	11.7	Regulatory subunit of type II PKA R-subunit

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000267584

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000286621	0.943	Adenosine kinase
2	9606.ENSP00000367615	0.930	Adenine phosphoribosyltransferase
3	9606.ENSP00000485525	0.918	Adenylosuccinate lyase
4	9606.ENSP00000300738	0.917	Ribonucleoside-diphosphate reductase large subunit
5	9606.ENSP00000286648	0.906	Deoxycytidine kinase
6	9606.ENSP00000251810	0.902	Ribonucleoside-diphosphate reductase subunit M2 B
7	9606.ENSP00000353165	0.902	Thiamin pyrophosphokinase 1
8	9606.ENSP00000353770	0.902	Ribonucleoside-diphosphate reductase subunit M2
9	9606.ENSP00000347213	0.900	Ectonucleoside triphosphate diphosphohydrolase 2
10	9606.ENSP00000355587	0.900	Cancer-related nucleoside-triphosphatase
11	9606.ENSP00000346577	0.891	Adenylate kinase isoenzyme 5
12	9606.ENSP00000298545	0.873	Adenylate kinase 8
13	9606.ENSP00000362271	0.853	Adenylate kinase isoenzyme 1
14	9606.ENSP00000410186	0.823	Adenylate kinase 9
15	9606.ENSP00000356785	0.777	Nucleoside diphosphate kinase 7
16	9606.ENSP00000371230	0.756	GTP:AMP phosphotransferase AK3, mitochondrial
17	9606.ENSP00000339933	0.725	Pyruvate kinase PKLR
18	9606.ENSP00000379802	0.725	AMP deaminase 3
19	9606.ENSP00000320171	0.712	Pyruvate kinase PKM
20	9606.ENSP00000430075	0.712	AMP deaminase 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004550	1.000	nucleoside diphosphate kinase activity
GO:0004017	1.000	adenylate kinase activity
GO:0004127	0.968	cytidylate kinase activity
GO:0005488	0.905	binding
GO:0005515	0.889	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.997	organic substance metabolic process
GO:0044237	0.997	cellular metabolic process
GO:0044238	0.994	primary metabolic process
GO:0006807	0.990	nitrogen compound metabolic process
GO:1901360	0.990	organic cyclic compound metabolic process
GO:0006725	0.990	cellular aromatic compound metabolic process
GO:0046483	0.987	heterocycle metabolic process
GO:0034641	0.984	cellular nitrogen compound metabolic process
GO:0044281	0.968	small molecule metabolic process
GO:0006139	0.964	nucleobase-containing compound metabolic process
GO:0006793	0.957	phosphorus metabolic process
GO:0006796	0.954	phosphate-containing compound metabolic process
GO:0006753	0.935	nucleoside phosphate metabolic process
GO:0009117	0.930	nucleotide metabolic process
GO:0016310	0.924	phosphorylation
GO:0009058	0.921	biosynthetic process
GO:1901293	0.914	nucleoside phosphate biosynthetic process
GO:0006165	0.901	nucleoside diphosphate phosphorylation
GO:0009141	0.884	nucleoside triphosphate metabolic process
GO:0009142	0.829	nucleoside triphosphate biosynthetic process
GO:1901564	0.464	organonitrogen compound metabolic process
GO:0050896	0.411	response to stimulus
GO:1901135	0.369	carbohydrate derivative metabolic process
GO:0050789	0.347	regulation of biological process
GO:0050794	0.313	regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.999	cytosol
GO:0043226	0.951	organelle
GO:0043227	0.925	membrane-bounded organelle
GO:0043229	0.848	intracellular organelle
GO:0043231	0.755	intracellular membrane-bounded organelle
GO:0043232	0.414	intracellular non-membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.7.4.6	1.000	nucleoside-diphosphate kinase.
RHEA:12973	1.000	AMP + ATP = 2 ADP
EC:2.7.4.3	1.000	adenylate kinase.
EC:2.7.4.14	0.968	UMP/CMP kinase.

[back to server]