StarFunc result for job id Q96M83

User Input

>input (1385 residues)
MKPVKHLLTTSNKSANVPALTTKKGLHNLPLSPELKEKHNAKLIHDKIEPMVLRSPPTGE
SILRYALPIPSSKTKNLLPEDEMIGKIIKHLKMVVSTLEETYGHCDQNGEEPFVKHEHEE
LSLSVGDDMNSFLTYCSQFAAQLEEALKEEQNILESLFKWFQWQVNQMEEISKDQTLLQA
EPPKPDKTVILNIAEIVRLVQRFEELKNRLKQRSKSSVKVMLSKTMDKENRPEAVKSCEA
LAQKIEEFLEAHSTDEFKDVSATEPQTAHSMTNRFNAMLKVFENQANMLERAVNDQVLLD
AEYKQMQCDFQLLSEEKLVLENELQKLKDKEKTKPTNNRTKKAVKTVKKKDKGKSEDSEK
KMSPEKEFKIKEDLDQVQKVARLEIENKVLQEQLKQALQEAEKAKHQLNYFLNQEKLLKS
EGKTETTMQVGNSQTKVKGEDSKNIPLEKETRKSLVSDSGGQRTSDKIQEYPQITAQSGR
LIEKSSEKKRSSPAISDLSQILKSQDESAFLESSNEVSVAENQSYKSPSETHDKSLTTVS
SSKEVQDSLSVGTLAQKNETVISPFILPPVLTESKKADVSEEQLQKMTEEQTYQAAEKSQ
ADSEVPDENLMVENKDSVTKVQIEQMKQRTSSMERHEETLTTPQLPEDMVLVSRIQSETK
NLKATRNESFHSHNDVPEENLMLEQDTKSKTEVEVKKQKSFQDNQLSTHNEVPNERLVVE
HQESLSKTKLQIKKQETSTEQPLTTPDKEPNENLILRHQDSMSKSEMQVKEQRTLKGQRI
ITHDEEPGKNLVLEHQDSVSKLEMQIEKTKKLPREKRHSTHDEESGENPMLKHQDSVSKI
QVQLEIQETSEGEGRSIPDKNSMFVHQDSVSKLQMQEKKKITPGRERRNTRIVVPNENVI
SVHQDSKSKLQMQEKKQINSGVERHKTFPLEIKKKDISLEHLLPEEKVLLSRSESQTKKL
QAKVTSRKIKNEAASELPDTAENLPAMYPSISDLIIQFDLNKVVETDIESLRGALGRRLL
NDEFKTQSKSFPGPDIEQLTDAFGRDILKDEFKTRSKSLPETDERLHSTTERGTINDAIK
TQLKRKSYPETVLKHLKGVNGKDIIKHLINIQSKSHGETDKEHLADDTGRGIIKGSINAQ
LKGHQKTDKNFFAYATGRGLMKESTTTQLKSHPETDKEFLADAIGRGIIIGPITTQLKSH
RETDKELLKDAIGRDIIKGPISAQLKSHQETDVEPLTNAIGSSKTIGEIKTQLRTHYDVN
LFKNKDMSVQRQEGIFTRSITPSKFPTKVINLSPFENKEETYEYSSPYVTAPSKAIYRTY
RAGPSFSKDIHLPLLNQLPSGHSKVVTLSQKTIEFTLPTVTNTVGKPTYKVLHAAARKSV
PHPYF

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q96M83	1.000	1.000	0.000	1385	1.000	1.000	Q96M83.pdb.gz	CCDC7_HUMAN Coiled-coil domain-containing protein 7 OS=Homo sapiens OX=9606 GN=CCDC7 PE=1 SV=3
2	AFDB:F4JW79	0.038	0.036	1.220E-8	1493	0.088	0.082	F4JW79.pdb.gz	RDM3_ARATH Protein RNA-directed DNA methylation 3 OS=Arabidopsis thaliana OX=3702 GN=RDM3 PE=1 SV=1
3	AFDB:P48681	0.047	0.041	1.460E-8	1621	0.130	0.111	P48681.pdb.gz	NEST_HUMAN Nestin OS=Homo sapiens OX=9606 GN=NES PE=1 SV=2
4	AFDB:P35658	0.046	0.034	4.627E-6	2090	0.155	0.102	P35658.pdb.gz	NU214_HUMAN Nuclear pore complex protein Nup214 OS=Homo sapiens OX=9606 GN=NUP214 PE=1 SV=2
5	AFDB:E7ESP9	0.048	0.071	7.041E-6	877	0.094	0.148	E7ESP9.pdb.gz	E7ESP9_HUMAN Neurofilament medium chain OS=Homo sapiens OX=9606 GN=NEFM PE=1 SV=1
6	AFDB:Q6XZL8	0.034	0.031	7.041E-6	1540	0.141	0.127	Q6XZL8.pdb.gz	Q6XZL8_MOUSE Histone-lysine N-methyltransferase, H3 lysine-79 specific OS=Mus musculus OX=10090 GN=Dot1l PE=1 SV=1
7	AFDB:Q54KI4	0.040	0.045	7.939E-6	1196	0.090	0.104	Q54KI4.pdb.gz	EPS15_DICDI Epidermal growth factor receptor substrate 15 homolog OS=Dictyostelium discoideum OX=44689 GN=eps15 PE=1 SV=1
8	AFDB:Q95TJ2	0.040	0.040	8.429E-6	1261	0.117	0.128	Q95TJ2.pdb.gz	Q95TJ2_DROME LP06813p OS=Drosophila melanogaster OX=7227 GN=Sdb PE=2 SV=1
9	AFDB:Q960V3	0.052	0.053	1.362E-5	1122	0.105	0.129	Q960V3.pdb.gz	MILT_DROME Trafficking kinesin-binding protein milt OS=Drosophila melanogaster OX=7227 GN=milt PE=1 SV=1
10	AFDB:Q00083	0.046	0.040	1.731E-5	1676	0.131	0.109	Q00083.pdb.gz	APSA_EMENI Anucleate primary sterigmata protein A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=apsA PE=1 SV=2
11	PDB:1qo0E	0.032	0.174	1.537	194	0.004	0.026	1qo0E.pdb.gz	Crystal Structure and Induction Mechanism of Amic-Amir: A Ligand-Regulated Transcription Antitermination Complex
12	PDB:6sh3A	0.032	0.098	1.632	376	0.012	0.043	6sh3A.pdb.gz	Structure of the Bcs1 AAA-ATPase suggests an airlock-like translocation mechanism for folded proteins.
13	PDB:6ukoA	0.037	0.113	1.840	371	0.011	0.040	6ukoA.pdb.gz	Structures of AAA protein translocase Bcs1 suggest translocation mechanism of a folded protein.
14	PDB:4knyB	0.028	0.133	2.203	226	0.008	0.049	4knyB.pdb.gz	An asymmetric heterodomain interface stabilizes a response regulator-DNA complex.
15	PDB:6giqD	0.033	0.139	2.203	248	0.012	0.069	6giqD.pdb.gz	Cryo-EM structure of the yeast respiratory supercomplex.
16	PDB:7rhsA	0.037	0.100	2.801	456	0.015	0.046	7rhsA.pdb.gz
17	PDB:7r5jD4	0.036	0.038	3.158	1312	0.011	0.011	7r5jD4.pdb.gz	AI-based structure prediction empowers integrative structural analysis of human nuclear pores
18	PDB:3c98B	0.052	0.259	4.262	230	0.024	0.143	3c98B.pdb.gz
19	PDB:3jb9W	0.037	0.095	4.262	426	0.026	0.085	3jb9W.pdb.gz	Structure of a yeast spliceosome at 3.6-angstrom resolution
20	PDB:6kxkD	0.037	0.076	4.262	553	0.009	0.022	6kxkD.pdb.gz	Crystal Structure of an Arabidopsis Copine providing insights into this protein family

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q96M83	0.0	2814	1385	1.000	1.000	CCDC7_HUMAN Coiled-coil domain-containing protein 7 OS=Homo sapiens OX=9606 GN=CCDC7 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF15368 BioT2	1.1e-85	297.3	Spermatogenesis family BioT2

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9597.XP_008965880.1

Rank	PPI partner	STRING score	Description
1	9597.XP_008967594.1	0.575	Fibronectin type III and ankyrin repeat domains 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050789	0.778	regulation of biological process
GO:0009987	0.430	cellular process
GO:0050794	0.394	regulation of cellular process
GO:0007017	0.346	microtubule-based process
GO:0000003	0.345	reproduction
GO:0022414	0.344	reproductive process
GO:0007018	0.317	microtubule-based movement

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043227	0.999	membrane-bounded organelle
GO:0005856	0.996	cytoskeleton
GO:0005737	0.990	cytoplasm
GO:0005634	0.989	nucleus
GO:0005815	0.982	microtubule organizing center
GO:0031981	0.965	nuclear lumen
GO:0005829	0.963	cytosol
GO:0005929	0.947	cilium
GO:0005654	0.899	nucleoplasm
GO:0005814	0.396	centriole

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]