StarFunc result for job id Q96M86

User Input

>input (1400 residues)
MVPEERRVGLSSDETSSDSLKSWHSICVLDSKEQPLACQQKQRQFVKPVTESEQPTVLEL
LLAELRTLFSAVLQDSSPAAWRYLHAVLGLLPPYRELLVGHLDLLPFLEQLYCWAPWVQT
HLHLDLLGAIVQAFPPDSSLLDSASHADCCPQKRRLHHRPPCPACPFVQAQWSRQQVKEE
LATWLRPLTLPELQRCLGIVGAQVALEEAVWLDGLSLLPLALAADIPVRYESSDTDNAEV
EPVGRKETRSQLDYEVPREKAFQKSSTGFSPETSFLDSQVMTALKMERYLKKIHFLYLNV
APSRYFRPYSLMVVPPDKVNPEHYIFSPFGILHVHPVEGSETMTLGTWHHHCVLWQQLQF
IPFFKYCLLRKSFTCWKKNVRLQGLHRLQKFLENHLLLAVPHFGAGLLHISRLLQELHSV
SWLPQELDRCYELLDLQTALAEEKHKALRLLHRCLNLCTSILRLVHEDTYHMQQCLQERV
QNCDRIRTGQGSIYLQRVQHKQLEQKLKQAEAWWLQLGKFARLVDYMICQSLISVLEEQI
TSFVANILQAPRQKPFLSSQLVFDDHGQLSHVPCVENMIQTLTGGLQSVKTSALQVVQSA
DLKTSSDSLYSEEEDEEEDSKDEFLMPKFQGQPSDAVSIFCGPNVGLVWPWKSHPIAGIL
EVRGCRLRGQYFPHNYKQLEEDLDNNPKIQQALNIQQVLLEGVLCKVQEFCREHHWITGI
YEFLQSWGPQKLEDMRGGPIKNYVTLVSRLNVWQARVSSMPIELLTKGGLLLLSCHDVQA
EMESKLNSIRKDILAHVQNECWNLSQQLMTELTDFMHIFRTINSDIHAIAQCTQKLNEAN
EQYVELEERMEYVRALHELIRNHFSLFSAENEALDISVRRQFGESPIPPCPPPPQPHLLH
CPLLAPQLLDMWEAFQFEKSQASEFLLSKRHAIMPKLQQLMAAALAELEGLLAKALSGPF
MDPTQDQRSTEHQLVSLERQFQNTVSDLSELHHAYAIFTEDETPVPLPICGTRPIVQQQR
IWHLYRVISENISEWKCMAFAKFSPAMAQEKTEGWLTEAARMSTTLELHSPVLQHCMRIL
GEFRSYLPLLTKLGSLHPQSLNCQCLLRALGLGSLQTIELLTLGQLLTYPLLEFADRINQ
VWQNENERIHAQETIRRLQRYWEARQLRLLNFILHVPYEPPASERSKRQVLRSPQWEVVD
KDSGTFILSDYSNLQDSIQESLQVLSKILAIEKSGDLNKIALEWVAIMHGLGALLEVWLT
FQQKWIFLNKVLHEMKIQFPNADLNSRFKVMDDQYRTLMRISVADPMVLSLVVPSAERSP
YFQGQQLQQLLQAGSVELEGIIMSLESVLYGVCAHFPRLFFLSDSELVALLAARLESCEA
QLWVRRCFPHVHAVSFRSCP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:7z8fe	0.198	0.080	3.300E-15	4579	0.094	0.029	7z8fe.pdb.gz	Structure of dynein-dynactin on microtubules shows tandem adaptor binding.
2	AFDB:Q9VN30	0.186	0.233	7.813E-11	1079	0.063	0.082	Q9VN30.pdb.gz	Q9VN30_DROME Dynein heavy chain linker domain-containing protein OS=Drosophila melanogaster OX=7227 GN=sac PE=4 SV=3
3	PDB:7z8gA	0.191	0.092	9.700E-7	3047	0.044	0.020	7z8gA.pdb.gz	Structure of dynein-dynactin on microtubules shows tandem adaptor binding.
4	PDB:4w8fB	0.111	0.062	1.357E-3	2609	0.027	0.015	4w8fB.pdb.gz	Allosteric communication in the Dynein motor domain.
5	PDB:7mi6A	0.109	0.066	4.231E-3	2419	0.029	0.017	7mi6A.pdb.gz	Targeting allostery in the Dynein motor domain with small molecule inhibitors.
6	PDB:5nugA	0.141	0.069	2.815E-2	2920	0.031	0.015	5nugA.pdb.gz	Cryo-EM Reveals How Human Cytoplasmic Dynein Is Auto-inhibited and Activated.
7	PDB:7qpgW	0.085	0.123	3.475E-2	779	0.049	0.087	7qpgW.pdb.gz
8	AFDB:Q24146	0.050	0.057	5.112E-2	1113	0.086	0.108	Q24146.pdb.gz	Q24146_DROME HLH106 OS=Drosophila melanogaster OX=7227 GN=SREBP PE=2 SV=1
9	PDB:3gjxA	0.060	0.071	8.415E-2	1041	0.094	0.127	3gjxA.pdb.gz	Crystal Structure of the Nuclear Export Receptor CRM1 in Complex with Snurportin1 and RanGTP.
10	PDB:7qp6y	0.053	0.080	8.415E-2	697	0.044	0.088	7qp6y.pdb.gz	Conformational rearrangements upon start codon recognition in human 48S translation initiation complex.
11	AFDB:F8VQ70	0.051	0.051	1.091E-1	1398	0.129	0.129	F8VQ70.pdb.gz	F8VQ70_MOUSE S phase cyclin A-associated protein in the ER OS=Mus musculus OX=10090 GN=Scaper PE=1 SV=1
12	AFDB:Q55BN0	0.067	0.061	1.291E-1	1662	0.118	0.099	Q55BN0.pdb.gz	MED23_DICDI Putative mediator of RNA polymerase II transcription subunit 23 OS=Dictyostelium discoideum OX=44689 GN=med23 PE=3 SV=1
13	AFDB:P55937	0.042	0.040	2.140E-1	1487	0.131	0.124	P55937.pdb.gz	GOGA3_MOUSE Golgin subfamily A member 3 OS=Mus musculus OX=10090 GN=Golga3 PE=1 SV=3
14	AFDB:Q38C46	0.055	0.054	2.140E-1	1405	0.080	0.080	Q38C46.pdb.gz	Q38C46_TRYB2 CHAT domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.70.5860 PE=4 SV=1
15	PDB:7r5jB0	0.043	0.038	2.411E-1	1748	0.091	0.073	7r5jB0.pdb.gz	AI-based structure prediction empowers integrative structural analysis of human nuclear pores
16	PDB:3m62A	0.061	0.082	2.736E-1	955	0.053	0.077	3m62A.pdb.gz
17	AFDB:Q3URY6	0.051	0.075	4.567E-1	854	0.076	0.124	Q3URY6.pdb.gz	ARMC2_MOUSE Armadillo repeat-containing protein 2 OS=Mus musculus OX=10090 GN=Armc2 PE=2 SV=3
18	AFDB:A0A024RCS3	0.046	0.083	5.182E-1	740	0.047	0.089	A0A024RCS3.pdb.gz	A0A024RCS3_HUMAN Death domain-associated protein 6 OS=Homo sapiens OX=9606 PE=3 SV=1
19	AFDB:Q580Q1	0.045	0.069	5.880E-1	835	0.104	0.175	Q580Q1.pdb.gz	Q580Q1_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb04.24M18.120 PE=4 SV=1
20	AFDB:Q0WQK1	0.049	0.058	6.133E-1	961	0.106	0.154	Q0WQK1.pdb.gz	Q0WQK1_ARATH Uncharacterized protein At1g27595 OS=Arabidopsis thaliana OX=3702 GN=At1g27595 PE=2 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	D3Z2X2	0.0	1844	4749	0.675	0.199	DNHD1_MOUSE Dynein heavy chain domain-containing protein 1 OS=Mus musculus OX=10090 GN=Dnhd1 PE=1 SV=3
2	Q96M86	0.0	2879	4753	1.000	0.295	DNHD1_HUMAN Dynein heavy chain domain-containing protein 1 OS=Homo sapiens OX=9606 GN=DNHD1 PE=1 SV=2
3	Q57VT8	1.47e-15	85.5	4112	0.051	0.017	Q57VT8_TRYB2 Dynein heavy chain, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb07.29K4.310 PE=4 SV=1
4	A0A6H2EJG3	3.60e-13	77.4	4065	0.046	0.016	A0A6H2EJG3_DROME Dynein heavy chain at 36C, isoform C OS=Drosophila melanogaster OX=7227 GN=Dhc36C PE=3 SV=1
5	Q9VJC6	3.98e-13	77.4	4024	0.046	0.016	Q9VJC6_DROME Dynein heavy chain at 36C, isoform B OS=Drosophila melanogaster OX=7227 GN=Dhc36C PE=3 SV=2
6	E7FGT8	2.05e-10	68.6	4626	0.060	0.018	E7FGT8_DANRE Dynein heavy chain 10, axonemal OS=Danio rerio OX=7955 GN=si:dkeyp-86b9.1 PE=1 SV=2
7	F7ABZ6	9.78e-10	66.2	4534	0.059	0.018	F7ABZ6_MOUSE Dynein, axonemal, heavy chain 10 OS=Mus musculus OX=10090 GN=Dnah10 PE=1 SV=2
8	D3YYQ8	1.09e-09	66.2	4591	0.059	0.018	D3YYQ8_MOUSE Dynein, axonemal, heavy chain 10 OS=Mus musculus OX=10090 GN=Dnah10 PE=1 SV=2
9	Q383F6	2.96e-09	64.7	4242	0.066	0.022	Q383F6_TRYB2 Dynein heavy chain, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.3010 PE=4 SV=1
10	Q580B5	3.66e-09	64.3	4448	0.054	0.017	Q580B5_TRYB2 Dynein heavy chain, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb04.5E12.710 PE=4 SV=1
11	Q9VWZ3	5.15e-08	60.5	4081	0.072	0.025	Q9VWZ3_DROME Dynein heavy chain at 16F OS=Drosophila melanogaster OX=7227 GN=Dhc16F PE=3 SV=1
12	Q9P225	5.87e-08	60.5	4427	0.051	0.016	DYH2_HUMAN Dynein axonemal heavy chain 2 OS=Homo sapiens OX=9606 GN=DNAH2 PE=1 SV=3
13	P0C6F1	7.68e-08	60.1	4456	0.049	0.015	DYH2_MOUSE Dynein axonemal heavy chain 2 OS=Mus musculus OX=10090 GN=Dnah2 PE=1 SV=1
14	Q19020	2.22e-07	58.5	4568	0.039	0.012	DYHC_CAEEL Dynein heavy chain, cytoplasmic OS=Caenorhabditis elegans OX=6239 GN=dhc-1 PE=1 SV=1
15	Q9SMH3	2.79e-07	58.2	4625	0.050	0.015	DYH1A_CHLRE Dynein-1-alpha heavy chain, flagellar inner arm I1 complex OS=Chlamydomonas reinhardtii OX=3055 GN=DHC1 PE=1 SV=1
16	Q384K3	3.39e-07	57.8	4152	0.051	0.017	Q384K3_TRYB2 Dynein heavy chain, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.0390 PE=4 SV=1
17	E9Q3H7	5.07e-07	57.4	4092	0.035	0.012	E9Q3H7_MOUSE Dynein, axonemal, heavy chain 6 OS=Mus musculus OX=10090 GN=Dnah6 PE=1 SV=1
18	E9Q0B6	5.29e-07	57.4	4144	0.035	0.012	E9Q0B6_MOUSE Dynein, axonemal, heavy chain 6 OS=Mus musculus OX=10090 GN=Dnah6 PE=1 SV=1
19	A0A0B4LH20	2.66e-06	55.1	4724	0.034	0.010	A0A0B4LH20_DROME Uncharacterized protein, isoform G OS=Drosophila melanogaster OX=7227 GN=Dhc1 PE=3 SV=1
20	P37276	7.15e-06	53.5	4639	0.027	0.008	DYHC_DROME Dynein heavy chain, cytoplasmic OS=Drosophila melanogaster OX=7227 GN=Dhc64C PE=2 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF09036 Bcr-Abl_Oligo	6.8e+02	11.6	Bcr-Abl oncoprotein oligomerisation domain
2	PF08393 DHC_N2	1.6e-33	128.1	Dynein heavy chain, N-terminal region 2
3	PF19037 Fuz_longin_2	26	16.3	Second Longin domain of FUZ, MON1 and HPS1

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000254579

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000339918	0.750	X-ray radiation resistance-associated protein 1
2	9606.ENSP00000381003	0.712	Tetratricopeptide repeat protein 28
3	9606.ENSP00000366221	0.677	Zinc finger protein castor homolog 1
4	9606.ENSP00000262424	0.661	Cysteine-rich secretory protein LCCL domain-containing 2
5	9606.ENSP00000300778	0.645	Olfactory receptor 51Q1
6	9606.ENSP00000401966	0.637	Olfactory receptor 1M1
7	9606.ENSP00000272091	0.610	Replication stress response regulator SDE2
8	9606.ENSP00000398798	0.598	Zinc finger protein 142
9	9606.ENSP00000482202	0.597	Phosphatidylinositol-glycan biosynthesis class W protein
10	9606.ENSP00000356319	0.571	Kinesin-like protein KIF14
11	9606.ENSP00000378320	0.554	Tetratricopeptide repeat protein 7A
12	9606.ENSP00000480538	0.551	Dynein intermediate chain 1, axonemal
13	9606.ENSP00000477310	0.550	Dynein light chain 2, cytoplasmic
14	9606.ENSP00000363524	0.545	Chromosome-associated kinesin KIF4A
15	9606.ENSP00000327009	0.524	CAP-Gly domain containing linker protein family member 4
16	9606.ENSP00000358374	0.522	Protein SCAF11
17	9606.ENSP00000477141	0.520	DOMON domain-containing protein FRRS1L
18	9606.ENSP00000329565	0.517	Speedy protein E3
19	9606.ENSP00000369784	0.513	Tubulin alpha chain-like 3
20	9606.ENSP00000370013	0.509	Pentatricopeptide repeat-containing protein 2, mitochondrial

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0140657	0.958	ATP-dependent activity
GO:0003774	0.402	cytoskeletal motor activity
GO:0003777	0.315	microtubule motor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0060271	0.976	cilium assembly
GO:0007281	0.972	germ cell development
GO:0007286	0.957	spermatid development
GO:0030317	0.956	flagellated sperm motility
GO:0044458	0.936	motile cilium assembly
GO:0120316	0.887	sperm flagellum assembly

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0036126	0.998	sperm flagellum
GO:0005576	0.754	extracellular region
GO:0043230	0.676	extracellular organelle
GO:1903561	0.662	extracellular vesicle
GO:0005622	0.594	intracellular anatomical structure
GO:0005615	0.584	extracellular space
GO:0070062	0.521	extracellular exosome
GO:0043229	0.398	intracellular organelle
GO:0005737	0.300	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]