StarFunc result for job id Q96M94

User Input

>input (604 residues)
MAGDVEGFCSSIHDTSVSAGFRALYEEGLLLDVTLVIEDHQFQAHKALLATQSDYFRIMF
TADMRERDQDKIHLKGLTATGFSHVLQFMYYGTIELSMNTVHEILQAAMYVQLIEVVKFC
CSFLLAKICLENCAEIMRLLDDFGVNIEGVREKLDTFLLDNFVPLMSRPDFLSYLSFEKL
MSYLDNDHLSRFPEIELYEAVQSWLRHDRRRWRHTDTIIQNIRFCLMTPTSVFEKVKTSE
FYRYSRQLRYEVDQALNYFQNVHQQPLLDMKSSRIRSAKPQTTVFRGMIGHSMVNSKILL
LKKPRVWWELEGPQVPLRPDCLAIVNNFVFLLGGEELGPDGEFHASSKVFRYDPRQNSWL
QMADMSVPRSEFAVGVIGKFIYAVAGRTRDETFYSTERYDITNDKWEFVDPYPVNKYGHE
GTVLNNKLFITGGITSSSTSKQVCVFDPSKEGTIEQRTRRTQVVTNCWENKSKMNYARCF
HKMISYNGKLYVFGGVCVILRASFESQGCPSTEVYNPETDQWTILASMPIGRSGHGVTVL
DKQIMVLGGLCYNGHYSDSILTFDPDENKWKEDEYPRMPCKLDGLQVCNLHFPDYVLDEV
RRCN

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q96M94	1.000	1.000	0.000	604	1.000	1.000	Q96M94.pdb.gz	KLH15_HUMAN Kelch-like protein 15 OS=Homo sapiens OX=9606 GN=KLHL15 PE=1 SV=2
2	AFDB:Q9P2N7	0.849	0.787	4.171E-54	655	0.311	0.287	Q9P2N7.pdb.gz	KLH13_HUMAN Kelch-like protein 13 OS=Homo sapiens OX=9606 GN=KLHL13 PE=1 SV=3
3	AFDB:Q53GT1	0.801	0.765	7.226E-54	634	0.290	0.276	Q53GT1.pdb.gz	KLH22_HUMAN Kelch-like protein 22 OS=Homo sapiens OX=9606 GN=KLHL22 PE=1 SV=2
4	AFDB:Q53HC5	0.867	0.852	1.522E-52	615	0.300	0.294	Q53HC5.pdb.gz	KLH26_HUMAN Kelch-like protein 26 OS=Homo sapiens OX=9606 GN=KLHL26 PE=1 SV=2
5	AFDB:Q8BWA5	0.786	0.752	3.371E-51	634	0.258	0.246	Q8BWA5.pdb.gz	KLH31_MOUSE Kelch-like protein 31 OS=Mus musculus OX=10090 GN=Klhl31 PE=1 SV=1
6	AFDB:Q8N4N3	0.872	0.856	4.782E-51	616	0.268	0.263	Q8N4N3.pdb.gz	KLH36_HUMAN Kelch-like protein 36 OS=Homo sapiens OX=9606 GN=KLHL36 PE=1 SV=1
7	AFDB:Q96NJ5	0.770	0.753	8.285E-51	620	0.280	0.273	Q96NJ5.pdb.gz	KLH32_HUMAN Kelch-like protein 32 OS=Homo sapiens OX=9606 GN=KLHL32 PE=1 SV=2
8	AFDB:Q69ZK5	0.638	0.613	8.997E-47	630	0.278	0.267	Q69ZK5.pdb.gz	KLH14_MOUSE Kelch-like protein 14 OS=Mus musculus OX=10090 GN=Klhl14 PE=1 SV=2
9	AFDB:Q8WZ60	0.614	0.600	2.558E-45	621	0.215	0.209	Q8WZ60.pdb.gz	KLHL6_HUMAN Kelch-like protein 6 OS=Homo sapiens OX=9606 GN=KLHL6 PE=1 SV=3
10	AFDB:Q8N239	0.700	0.663	3.815E-45	644	0.273	0.256	Q8N239.pdb.gz	KLH34_HUMAN Kelch-like protein 34 OS=Homo sapiens OX=9606 GN=KLHL34 PE=2 SV=1
11	PDB:2uvkB	0.387	0.646	1.319E-13	349	0.070	0.120	2uvkB.pdb.gz
12	PDB:5gq0A	0.337	0.579	1.780E-13	338	0.079	0.142	5gq0A.pdb.gz
13	PDB:5gqtA	0.349	0.442	3.582E-13	470	0.093	0.119	5gqtA.pdb.gz
14	PDB:2zwaB	0.336	0.299	5.295E-11	683	0.058	0.051	2zwaB.pdb.gz	Structural basis of tRNA modification with CO2 fixation and methylation by wybutosine synthesizing enzyme TYW4.
15	PDB:6oemB	0.313	0.506	7.794E-8	346	0.096	0.168	6oemB.pdb.gz	Cutting antiparallel DNA strands in a single active site.
16	PDB:6dbjD	0.296	0.468	1.734E-7	352	0.084	0.145	6dbjD.pdb.gz	DNA melting initiates the RAG catalytic pathway.
17	PDB:7mq8SG	0.263	0.377	9.015E-7	389	0.076	0.118	7mq8SG.pdb.gz	Nucleolar maturation of the human small subunit processome.
18	PDB:3sfzA	0.283	0.164	3.305E-6	1133	0.086	0.046	3sfzA.pdb.gz	Crystal structure of full-length Apaf-1: how the death signal is relayed in the mitochondrial pathway of apoptosis.
19	PDB:6wcqC	0.185	0.806	3.839E-6	130	0.055	0.254	6wcqC.pdb.gz
20	PDB:1ri6A	0.333	0.547	4.036E-6	333	0.066	0.120	1ri6A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q96M94	0.0	1268	604	1.000	1.000	KLH15_HUMAN Kelch-like protein 15 OS=Homo sapiens OX=9606 GN=KLHL15 PE=1 SV=2
2	Q9P2J3	1.46e-100	320	617	0.321	0.314	KLHL9_HUMAN Kelch-like protein 9 OS=Homo sapiens OX=9606 GN=KLHL9 PE=1 SV=2
3	Q9P2N7	4.81e-100	320	655	0.320	0.295	KLH13_HUMAN Kelch-like protein 13 OS=Homo sapiens OX=9606 GN=KLHL13 PE=1 SV=3
4	Q53HC5	1.48e-92	299	615	0.306	0.301	KLH26_HUMAN Kelch-like protein 26 OS=Homo sapiens OX=9606 GN=KLHL26 PE=1 SV=2
5	Q99JN2	8.59e-81	268	634	0.300	0.285	KLH22_MOUSE Kelch-like protein 22 OS=Mus musculus OX=10090 GN=Klhl22 PE=1 SV=1
6	Q53GT1	4.35e-80	266	634	0.300	0.285	KLH22_HUMAN Kelch-like protein 22 OS=Homo sapiens OX=9606 GN=KLHL22 PE=1 SV=2
7	Q8BWA5	2.85e-74	251	634	0.258	0.246	KLH31_MOUSE Kelch-like protein 31 OS=Mus musculus OX=10090 GN=Klhl31 PE=1 SV=1
8	Q8N4N3	6.07e-74	250	616	0.267	0.261	KLH36_HUMAN Kelch-like protein 36 OS=Homo sapiens OX=9606 GN=KLHL36 PE=1 SV=1
9	Q9H511	9.88e-72	244	634	0.250	0.238	KLH31_HUMAN Kelch-like protein 31 OS=Homo sapiens OX=9606 GN=KLHL31 PE=2 SV=1
10	Q96NJ5	4.33e-69	237	620	0.283	0.276	KLH32_HUMAN Kelch-like protein 32 OS=Homo sapiens OX=9606 GN=KLHL32 PE=1 SV=2
11	Q9P2G3	5.23e-60	213	628	0.238	0.229	KLH14_HUMAN Kelch-like protein 14 OS=Homo sapiens OX=9606 GN=KLHL14 PE=1 SV=2
12	Q69ZK5	6.84e-60	212	630	0.238	0.229	KLH14_MOUSE Kelch-like protein 14 OS=Mus musculus OX=10090 GN=Klhl14 PE=1 SV=2
13	Q8N239	1.29e-59	212	644	0.281	0.264	KLH34_HUMAN Kelch-like protein 34 OS=Homo sapiens OX=9606 GN=KLHL34 PE=2 SV=1
14	Q6IQ08	5.56e-56	198	470	0.214	0.274	Q6IQ08_HUMAN KLHL32 protein OS=Homo sapiens OX=9606 GN=KLHL32 PE=1 SV=1
15	E9Q4F2	8.57e-56	200	574	0.245	0.258	KLH18_MOUSE Kelch-like protein 18 OS=Mus musculus OX=10090 GN=Klhl18 PE=1 SV=1
16	Q9Y2M5	1.43e-54	197	609	0.250	0.248	KLH20_HUMAN Kelch-like protein 20 OS=Homo sapiens OX=9606 GN=KLHL20 PE=1 SV=4
17	O94889	1.55e-54	196	574	0.238	0.251	KLH18_HUMAN Kelch-like protein 18 OS=Homo sapiens OX=9606 GN=KLHL18 PE=1 SV=3
18	A0A2R8Q1W5	8.59e-54	195	587	0.255	0.262	KEP1B_DANRE Kelch-like ECH-associated protein 1B OS=Danio rerio OX=7955 GN=keap1b PE=1 SV=1
19	Q96PQ7	1.21e-52	194	755	0.237	0.189	KLHL5_HUMAN Kelch-like protein 5 OS=Homo sapiens OX=9606 GN=KLHL5 PE=1 SV=3
20	Q9VUU5	2.53e-52	191	623	0.248	0.241	KLHDB_DROME Kelch-like protein diablo OS=Drosophila melanogaster OX=7227 GN=dbo PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07707 BACK	1.2e-12	59.1	BTB And C-terminal Kelch
2	PF00651 BTB	5.1e-20	83.1	BTB/POZ domain
3	PF01344 Kelch_1	4.1e-34	127.2	Kelch motif
4	PF07646 Kelch_2	3.9e-10	50.6	Kelch motif
5	PF13415 Kelch_3	2.2e-14	64.6	Galactose oxidase, central domain
6	PF13418 Kelch_4	3.3e-19	79.9	Galactose oxidase, central domain
7	PF13854 Kelch_5	0.005	27.9	Kelch motif
8	PF13964 Kelch_6	1.2e-31	119.1	Kelch motif

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000332791

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000264414	0.888	Cullin-3
2	9606.ENSP00000368511	0.739	Putative uncharacterized protein CXorf58
3	9606.ENSP00000387536	0.733	[Pyruvate dehydrogenase (acetyl-transferring)] kinase isozyme 3, mitochondrial
4	9606.ENSP00000368666	0.680	Patched domain-containing protein 1
5	9606.ENSP00000368572	0.664	Diamine acetyltransferase 1
6	9606.ENSP00000417914	0.627	Ankyrin repeat and SOCS box protein 11
7	9606.ENSP00000370057	0.612	FERM and PDZ domain-containing protein 4
8	9606.ENSP00000363944	0.565	Ribosomal biogenesis protein LAS1L
9	9606.ENSP00000377001	0.544	Speckle-type POZ protein
10	9606.ENSP00000328059	0.540	E3 ubiquitin-protein ligase RLIM
11	9606.ENSP00000366886	0.536	Kelch-like protein 21
12	9606.ENSP00000368278	0.535	Interleukin-1 receptor accessory protein-like 1
13	9606.ENSP00000324287	0.531	Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein 2
14	9606.ENSP00000422473	0.516	Transmembrane protein 33
15	9606.ENSP00000216225	0.515	E3 ubiquitin-protein ligase RBX1
16	9606.ENSP00000341360	0.514	Cordon-bleu WH2 repeat protein like 1
17	9606.ENSP00000368824	0.512	Connector enhancer of kinase suppressor of ras 2
18	9606.ENSP00000361064	0.507	Multiple inositol polyphosphate phosphatase 1
19	9606.ENSP00000382628	0.505	DNA endonuclease RBBP8
20	9606.ENSP00000278715	0.500	Porphobilinogen deaminase

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:1990756	0.991	ubiquitin ligase-substrate adaptor activity
GO:0003824	0.342	catalytic activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0044238	0.996	primary metabolic process
GO:0071704	0.995	organic substance metabolic process
GO:0065007	0.987	biological regulation
GO:0019538	0.987	protein metabolic process
GO:0009987	0.981	cellular process
GO:0050794	0.980	regulation of cellular process
GO:0044237	0.820	cellular metabolic process
GO:0050896	0.656	response to stimulus
GO:0036211	0.586	protein modification process
GO:0051603	0.576	proteolysis involved in protein catabolic process
GO:0019222	0.537	regulation of metabolic process
GO:0006511	0.531	ubiquitin-dependent protein catabolic process
GO:0016567	0.488	protein ubiquitination
GO:0051716	0.453	cellular response to stimulus
GO:0010498	0.383	proteasomal protein catabolic process
GO:0048519	0.337	negative regulation of biological process
GO:0043161	0.324	proteasome-mediated ubiquitin-dependent protein catabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0031463	1.000	Cul3-RING ubiquitin ligase complex
GO:0043229	0.998	intracellular organelle
GO:0043227	0.985	membrane-bounded organelle
GO:0043231	0.984	intracellular membrane-bounded organelle
GO:0005737	0.961	cytoplasm
GO:0005634	0.955	nucleus
GO:0005829	0.928	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]