StarFunc result for job id Q96M95

User Input

>input (316 residues)
MSLGIMEEEDLAEYFRLQYGERLLQMLQKLPNVEGASESPSIWLLEKKKETEIMHQTMVQ
KKKMFQRRMETLNLRWEELGVKEAQLKAHIQKSEQFIQENDQKRIRAMKKANKERELKCQ
HMQELTKRKQEMVALRLEHQRLSAKLKDYYIFNKYLEKVVENSEFEEIHEVIARYKTLVS
MRHDLMQSAQEGQEKIERAKARLARYMEEKDDEILQQNNELARLQMRFDRARSNVIFWES
RWAHIQNTAAKKTLLLGTIKMATLNLFQIVSKHLKEVTEVALEDTHKQLDMIQQFIQDRS
DIWAEVKKKEQQRVRI

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q96M95	1.000	1.000	8.728E-41	316	1.000	1.000	Q96M95.pdb.gz	CCD42_HUMAN Coiled-coil domain-containing protein 42 OS=Homo sapiens OX=9606 GN=CCDC42 PE=1 SV=2
2	AFDB:Q5SV66	0.772	0.772	1.724E-35	316	0.864	0.864	Q5SV66.pdb.gz	CCD42_MOUSE Coiled-coil domain-containing protein 42 OS=Mus musculus OX=10090 GN=Ccdc42 PE=2 SV=2
3	AFDB:M1V4Y8	0.571	0.583	6.360E-8	308	0.247	0.253	M1V4Y8.pdb.gz	CFA73_CHLRE Cilia- and flagella-associated protein 73 OS=Chlamydomonas reinhardtii OX=3055 GN=FAP73 PE=1 SV=1
4	AFDB:Q9VIY3	0.476	0.452	4.539E-6	335	0.177	0.167	Q9VIY3.pdb.gz	Q9VIY3_DROME GH10882p OS=Drosophila melanogaster OX=7227 GN=Dmel\CG17564 PE=1 SV=1
5	AFDB:Q385W2	0.538	0.566	8.356E-5	299	0.190	0.201	Q385W2.pdb.gz	Q385W2_TRYB2 DUF4200 domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.02.2130 PE=4 SV=1
6	AFDB:Q502W7	0.321	0.189	5.577E-2	563	0.177	0.099	Q502W7.pdb.gz	CCD38_HUMAN Coiled-coil domain-containing protein 38 OS=Homo sapiens OX=9606 GN=CCDC38 PE=2 SV=1
7	AFDB:A8I4E9	0.346	0.218	1.175E-1	576	0.206	0.113	A8I4E9.pdb.gz	CP100_CHLRE Cilia- and flagella-associated protein 100 OS=Chlamydomonas reinhardtii OX=3055 GN=FAP100 PE=1 SV=1
8	AFDB:P11047	0.286	0.066	2.475E-1	1609	0.171	0.034	P11047.pdb.gz	LAMC1_HUMAN Laminin subunit gamma-1 OS=Homo sapiens OX=9606 GN=LAMC1 PE=1 SV=3
9	AFDB:Q9DA73	0.317	0.275	4.873E-1	370	0.190	0.162	Q9DA73.pdb.gz	CCD89_MOUSE Coiled-coil domain-containing protein 89 OS=Mus musculus OX=10090 GN=Ccdc89 PE=1 SV=2
10	AFDB:Q9W2M0	0.294	0.155	7.317E-1	647	0.184	0.090	Q9W2M0.pdb.gz	Q9W2M0_DROME LD23155p OS=Drosophila melanogaster OX=7227 GN=Rbpn-5 PE=1 SV=2
11	PDB:7rroP	0.203	0.177	3.554	373	0.161	0.137	7rroP.pdb.gz	De novo identification of mammalian ciliary motility proteins using cryo-EM.
12	PDB:3j6bT	0.079	0.113	4.986	209	0.019	0.029	3j6bT.pdb.gz	Structure of the yeast mitochondrial large ribosomal subunit.
13	PDB:1qsdA	0.096	0.260	5.336	102	0.032	0.098	1qsdA.pdb.gz
14	PDB:3lssA	0.074	0.055	5.336	438	0.038	0.027	3lssA.pdb.gz	X-ray crystal structure of Seryl-tRNA synthetase from the eukaryotic parasite Trypanosoma brucei.
15	PDB:6gxnv	0.084	0.079	5.710	348	0.028	0.026	6gxnv.pdb.gz	Visualization of translation termination intermediates trapped by the Apidaecin 137 peptide during RF3-mediated recycling of RF1.
16	PDB:6hizCI	0.136	0.186	6.538	222	0.019	0.027	6hizCI.pdb.gz	Evolutionary shift toward protein-based architecture in trypanosomal mitochondrial ribosomes.
17	PDB:4i9qB	0.072	0.029	7.487	873	0.019	0.007	4i9qB.pdb.gz	A Remote Palm Domain Residue of RB69 DNA Polymerase Is Critical for Enzyme Activity and Influences the Conformation of the Active Site.
18	PDB:6xywBn	0.090	0.233	7.487	100	0.025	0.080	6xywBn.pdb.gz	Cryo-EM structure of the RNA-rich plant mitochondrial ribosome.
19	PDB:2jowA	0.102	0.305	8.573	83	0.025	0.096	2jowA.pdb.gz
20	PDB:6wczA	0.119	0.109	9.174	350	0.047	0.043	6wczA.pdb.gz	Structural basis for STAT2 suppression by flavivirus NS5.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q5SV66	0.0	543	316	0.864	0.864	CCD42_MOUSE Coiled-coil domain-containing protein 42 OS=Mus musculus OX=10090 GN=Ccdc42 PE=2 SV=2
2	Q96M95	0.0	637	316	1.000	1.000	CCD42_HUMAN Coiled-coil domain-containing protein 42 OS=Homo sapiens OX=9606 GN=CCDC42 PE=1 SV=2
3	M1V4Y8	2.59e-25	105	308	0.244	0.250	CFA73_CHLRE Cilia- and flagella-associated protein 73 OS=Chlamydomonas reinhardtii OX=3055 GN=FAP73 PE=1 SV=1
4	Q385W2	2.89e-07	53.5	299	0.187	0.197	Q385W2_TRYB2 DUF4200 domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.02.2130 PE=4 SV=1
5	Q7TNF8	0.002	42.4	1846	0.165	0.028	RIMB1_MOUSE Peripheral-type benzodiazepine receptor-associated protein 1 OS=Mus musculus OX=10090 GN=Tspoap1 PE=2 SV=2
6	Q9JIR0	0.008	40.4	1847	0.158	0.027	RIMB1_RAT Peripheral-type benzodiazepine receptor-associated protein 1 OS=Rattus norvegicus OX=10116 GN=Tspoap1 PE=1 SV=2
7	Q494V2	0.015	39.3	611	0.120	0.062	CP100_HUMAN Cilia- and flagella-associated protein 100 OS=Homo sapiens OX=9606 GN=CFAP100 PE=1 SV=1
8	H9LAN6	0.047	38.1	1736	0.120	0.022	H9LAN6_MOUSE Histone-lysine N-methyltransferase, H3 lysine-79 specific OS=Mus musculus OX=10090 GN=Dot1l PE=2 SV=1
9	Q6XZL8	0.081	37.4	1540	0.120	0.025	Q6XZL8_MOUSE Histone-lysine N-methyltransferase, H3 lysine-79 specific OS=Mus musculus OX=10090 GN=Dot1l PE=1 SV=1
10	O95153	0.11	37.0	1857	0.152	0.026	RIMB1_HUMAN Peripheral-type benzodiazepine receptor-associated protein 1 OS=Homo sapiens OX=9606 GN=TSPOAP1 PE=1 SV=2
11	Q5YL88	0.11	37.0	1205	0.120	0.032	Q5YL88_MOUSE Histone-lysine N-methyltransferase, H3 lysine-79 specific (Fragment) OS=Mus musculus OX=10090 GN=Dot1l PE=2 SV=1
12	F7CVL0	0.12	36.6	1202	0.120	0.032	F7CVL0_MOUSE Histone-lysine N-methyltransferase, H3 lysine-79 specific (Fragment) OS=Mus musculus OX=10090 GN=Dot1l PE=1 SV=1
13	Q679P5	0.40	35.0	1114	0.120	0.034	Q679P5_MOUSE Histone-lysine N-methyltransferase, H3 lysine-79 specific OS=Mus musculus OX=10090 GN=Dot1l PE=2 SV=1
14	O74857	0.76	33.9	330	0.063	0.061	RPC4_SCHPO DNA-directed RNA polymerase III subunit rpc4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rpc53 PE=2 SV=1
15	Q502W7	0.84	33.9	563	0.104	0.059	CCD38_HUMAN Coiled-coil domain-containing protein 38 OS=Homo sapiens OX=9606 GN=CCDC38 PE=2 SV=1
16	B9EJA2	0.88	33.9	1648	0.108	0.021	CTTB2_MOUSE Cortactin-binding protein 2 OS=Mus musculus OX=10090 GN=Cttnbp2 PE=1 SV=2
17	A0A1W2P7C0	1.3	33.5	956	0.038	0.013	A0A1W2P7C0_MOUSE Utrophin OS=Mus musculus OX=10090 GN=Utrn PE=1 SV=1
18	Q61636	1.3	33.5	987	0.038	0.012	Q61636_MOUSE G-utrophin (Predicted protein) OS=Mus musculus OX=10090 GN=Utrn PE=1 SV=1
19	P34631	1.5	33.1	469	0.101	0.068	UBXN4_CAEEL UBX domain-containing protein 4 OS=Caenorhabditis elegans OX=6239 GN=ubxn-4 PE=1 SV=1
20	E9Q6R7	1.6	33.1	3430	0.038	0.003	E9Q6R7_MOUSE Utrophin OS=Mus musculus OX=10090 GN=Utrn PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13863 DUF4200	1.4e-22	91.7	Domain of unknown function (DUF4200)
2	PF18595 Nuf2_DHR10-like	19	16.7	Nuf2, DHR10-like domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000293845

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000309285	0.785	Coiled-coil domain containing 96
2	9606.ENSP00000345470	0.771	Coiled-coil domain containing 38
3	9606.ENSP00000379754	0.771	Coiled-coil domain-containing protein 125
4	9606.ENSP00000238156	0.763	Coiled-coil domain containing 92
5	9606.ENSP00000344749	0.754	Cilia- and flagella-associated protein 100
6	9606.ENSP00000409896	0.730	E3 ubiquitin-protein ligase CCNB1IP1
7	9606.ENSP00000219299	0.725	Coiled-coil domain-containing protein 113
8	9606.ENSP00000451000	0.717	Zinc finger and BTB domain-containing protein 1
9	9606.ENSP00000380690	0.680	BICD family-like cargo adapter 1
10	9606.ENSP00000242819	0.576	Coiled-coil domain containing 70
11	9606.ENSP00000376250	0.576	Coiled-coil domain-containing protein 50
12	9606.ENSP00000384376	0.561	Tudor domain containing 15
13	9606.ENSP00000315035	0.559	Protein phosphatase 1 regulatory subunit 42
14	9606.ENSP00000360560	0.558	T-complex-associated-testis-expressed 1
15	9606.ENSP00000380679	0.554	Coiled-coil domain-containing protein 40
16	9606.ENSP00000308873	0.551	Coiled-coil domain containing 74B
17	9606.ENSP00000405708	0.550	Coiled-coil domain-containing protein 39
18	9606.ENSP00000349568	0.548	Cilia and flagella associated protein 43
19	9606.ENSP00000307142	0.535	Testis-expressed sequence 37 protein
20	9606.ENSP00000335325	0.531	Coiled-coil domain containing 73

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.996	cellular process
GO:0007286	0.989	spermatid development
GO:0071840	0.651	cellular component organization or biogenesis
GO:0016043	0.635	cellular component organization
GO:0022607	0.581	cellular component assembly
GO:0006996	0.574	organelle organization
GO:0070925	0.409	organelle assembly
GO:0065007	0.332	biological regulation
GO:0007010	0.327	cytoskeleton organization
GO:0060271	0.323	cilium assembly
GO:0050789	0.307	regulation of biological process
GO:0035082	0.300	axoneme assembly

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043227	1.000	membrane-bounded organelle
GO:0005856	1.000	cytoskeleton
GO:0005737	0.997	cytoplasm
GO:0120025	0.995	plasma membrane bounded cell projection
GO:0005929	0.988	cilium
GO:0043231	0.854	intracellular membrane-bounded organelle
GO:0005634	0.762	nucleus
GO:0015630	0.692	microtubule cytoskeleton
GO:0005815	0.614	microtubule organizing center
GO:0097014	0.580	ciliary plasm
GO:0005930	0.512	axoneme
GO:0031514	0.440	motile cilium
GO:0005654	0.329	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]