StarFunc result for job id Q96M96

User Input

>input (766 residues)
MEEIKPASASCVSKEKPSKVSDLISRFEGGSSLSNYSDLKKESAVNLNAPRTPGRHGLTT
TPQQKLLSQHLPQRQGNDTDKTQGAQTCVANGVMAAQNQMECEEEKAATLSSDTSIQASE
PLLDTHIVNGERDETATAPASPTTDSCDGNASDSSYRTPGIGPVLPLEERGAETETKVQE
RENGESPLELEQLDQHHEMKETNEQKLHKIANELLLTERAYVNRLDLLDQVFYCKLLEEA
NRGSFPAEMVNKIFSNISSINAFHSKFLLPELEKRMQEWETTPRIGDILQKLAPFLKMYG
EYVKGFDNAMELVKNMTERIPQFKSVVEEIQKQKICGSLTLQHHMLEPVQRIPRYEMLLK
DYLRKLPPDSLDWNDAKKSLEIISTAASHSNSAIRKMENLKKLLEIYEMLGEEEDIVNPS
NELIKEGQILKLAARNTSAQERYLFLFNNMLLYCVPKFSLVGSKFTVRTRVGIDGMKIVE
TQNEEYPHTFQVSGKERTLELQASSAQDKEEWIKALQETIDAFHQRHETFRNAIAKDNDI
HSEVSTAELGKRAPRWIRDNEVTMCMKCKEPFNALTRRRHHCRACGYVVCWKCSDYKAQL
EYDGGKLSKVCKDCYQIISGFTDSEEKKRKGILEIESAEVSGNSVVCSFLQYMEKSKPWQ
KAWCVIPKQDPLVLYMYGAPQDVRAQATIPLLGYVVDEMPRSADLPHSFKLTQSKSVHSF
AADSEELKQKWLKVILLAVTGETPGGPNEHPATLDDHPEPKKKSEC

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q96M96	1.000	1.000	0.000	766	1.000	1.000	Q96M96.pdb.gz	FGD4_HUMAN FYVE, RhoGEF and PH domain-containing protein 4 OS=Homo sapiens OX=9606 GN=FGD4 PE=1 SV=2
2	AFDB:O88387	0.632	0.632	3.158E-100	766	0.832	0.832	O88387.pdb.gz	FGD4_RAT FYVE, RhoGEF and PH domain-containing protein 4 OS=Rattus norvegicus OX=10116 GN=Fgd4 PE=1 SV=1
3	AFDB:Q7Z6J4	0.344	0.392	5.471E-62	655	0.402	0.470	Q7Z6J4.pdb.gz	FGD2_HUMAN FYVE, RhoGEF and PH domain-containing protein 2 OS=Homo sapiens OX=9606 GN=FGD2 PE=1 SV=1
4	AFDB:Q8BY35	0.339	0.384	2.779E-61	655	0.401	0.469	Q8BY35.pdb.gz	FGD2_MOUSE FYVE, RhoGEF and PH domain-containing protein 2 OS=Mus musculus OX=10090 GN=Fgd2 PE=1 SV=1
5	AFDB:Q6ZNL6	0.297	0.185	4.182E-39	1462	0.249	0.131	Q6ZNL6.pdb.gz	FGD5_HUMAN FYVE, RhoGEF and PH domain-containing protein 5 OS=Homo sapiens OX=9606 GN=FGD5 PE=1 SV=3
6	AFDB:G5ED03	0.328	0.301	2.717E-38	844	0.205	0.186	G5ED03.pdb.gz	G5ED03_CAEEL Putative Rho guanine nucleotide exchange factor FGD-1 OS=Caenorhabditis elegans OX=6239 GN=fgd-1 PE=2 SV=1
7	AFDB:O94887	0.379	0.285	6.034E-33	1054	0.235	0.171	O94887.pdb.gz	FARP2_HUMAN FERM, ARHGEF and pleckstrin domain-containing protein 2 OS=Homo sapiens OX=9606 GN=FARP2 PE=1 SV=3
8	AFDB:Q91VS8	0.365	0.271	1.394E-32	1065	0.240	0.173	Q91VS8.pdb.gz	FARP2_MOUSE FERM, ARHGEF and pleckstrin domain-containing protein 2 OS=Mus musculus OX=10090 GN=Farp2 PE=1 SV=2
9	AFDB:F1LYQ8	0.363	0.274	3.967E-31	1049	0.219	0.160	F1LYQ8.pdb.gz	FARP1_RAT FERM, ARHGEF and pleckstrin domain-containing protein 1 OS=Rattus norvegicus OX=10116 GN=Farp1 PE=1 SV=2
10	AFDB:Q9TW28	0.248	0.129	1.649E-22	1737	0.146	0.064	Q9TW28.pdb.gz	MYOM_DICDI Myosin-M heavy chain OS=Dictyostelium discoideum OX=44689 GN=myoM PE=1 SV=1
11	PDB:4mt6A	0.278	0.464	3.247E-16	389	0.091	0.180	4mt6A.pdb.gz
12	PDB:7rx9A	0.258	0.434	1.227E-15	432	0.114	0.201	7rx9A.pdb.gz
13	PDB:4gouA	0.312	0.446	3.008E-10	507	0.072	0.108	4gouA.pdb.gz
14	PDB:3ljuX	0.139	0.242	6.065E-9	373	0.064	0.131	3ljuX.pdb.gz	Phosphorylation-independent dual-site binding of the FHA domain of KIF13 mediates phosphoinositide transport via centaurin alpha1.
15	PDB:6u3eA	0.121	0.222	8.446E-6	397	0.082	0.159	6u3eA.pdb.gz	Structural Organization and Dynamics of Homodimeric Cytohesin Family Arf GTPase Exchange Factors in Solution and on Membranes.
16	PDB:6bbpA	0.122	0.171	1.683E-5	520	0.078	0.115	6bbpA.pdb.gz	Structural Dynamics Control Allosteric Activation of Cytohesin Family Arf GTPase Exchange Factors.
17	PDB:5yqrA	0.126	0.326	2.754E-5	268	0.033	0.093	5yqrA.pdb.gz
18	PDB:4mk0A	0.127	0.149	4.289E-5	631	0.056	0.068	4mk0A.pdb.gz	Structural and functional analysis of g protein-coupled receptor kinase inhibition by paroxetine and a rationally designed analog.
19	PDB:3pvuA	0.120	0.147	7.019E-5	609	0.054	0.067	3pvuA.pdb.gz	Molecular Mechanism of Selectivity among G Protein-Coupled Receptor Kinase 2 Inhibitors.
20	PDB:6s9wA	0.117	0.211	1.789E-4	411	0.027	0.051	6s9wA.pdb.gz	Covalent-Allosteric Inhibitors to Achieve Akt Isoform-Selectivity.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O88387	0.0	1316	766	0.832	0.832	FGD4_RAT FYVE, RhoGEF and PH domain-containing protein 4 OS=Rattus norvegicus OX=10116 GN=Fgd4 PE=1 SV=1
2	P52734	0.0	639	960	0.415	0.331	FGD1_MOUSE FYVE, RhoGEF and PH domain-containing protein 1 OS=Mus musculus OX=10090 GN=Fgd1 PE=1 SV=2
3	P98174	0.0	638	961	0.415	0.331	FGD1_HUMAN FYVE, RhoGEF and PH domain-containing protein 1 OS=Homo sapiens OX=9606 GN=FGD1 PE=1 SV=2
4	Q49A55	0.0	912	471	0.564	0.917	Q49A55_HUMAN FGD4 protein OS=Homo sapiens OX=9606 GN=FGD4 PE=1 SV=1
5	Q7Z6J4	0.0	621	655	0.389	0.455	FGD2_HUMAN FYVE, RhoGEF and PH domain-containing protein 2 OS=Homo sapiens OX=9606 GN=FGD2 PE=1 SV=1
6	Q8BY35	0.0	609	655	0.383	0.447	FGD2_MOUSE FYVE, RhoGEF and PH domain-containing protein 2 OS=Mus musculus OX=10090 GN=Fgd2 PE=1 SV=1
7	Q91ZT5	0.0	1338	766	0.842	0.842	FGD4_MOUSE FYVE, RhoGEF and PH domain-containing protein 4 OS=Mus musculus OX=10090 GN=Fgd4 PE=1 SV=1
8	Q96M96	0.0	1599	766	1.000	1.000	FGD4_HUMAN FYVE, RhoGEF and PH domain-containing protein 4 OS=Homo sapiens OX=9606 GN=FGD4 PE=1 SV=2
9	Q5JSP0	5.25e-175	521	725	0.356	0.377	FGD3_HUMAN FYVE, RhoGEF and PH domain-containing protein 3 OS=Homo sapiens OX=9606 GN=FGD3 PE=1 SV=1
10	O88842	2.11e-166	499	733	0.350	0.366	FGD3_MOUSE FYVE, RhoGEF and PH domain-containing protein 3 OS=Mus musculus OX=10090 GN=Fgd3 PE=1 SV=1
11	A0A2X0SFF2	5.31e-65	238	1462	0.223	0.117	A0A2X0SFF2_HUMAN FGD5 (Fragment) OS=Homo sapiens OX=9606 GN=FGD5 PE=4 SV=1
12	Q6ZNL6	5.31e-65	238	1462	0.223	0.117	FGD5_HUMAN FYVE, RhoGEF and PH domain-containing protein 5 OS=Homo sapiens OX=9606 GN=FGD5 PE=1 SV=3
13	G5ECM5	2.22e-61	223	826	0.208	0.192	G5ECM5_CAEEL DH domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=exc-5 PE=1 SV=1
14	B7ZM68	1.45e-60	224	1178	0.213	0.138	B7ZM68_HUMAN FGD5 protein OS=Homo sapiens OX=9606 GN=FGD5 PE=1 SV=1
15	G5ED03	5.93e-60	219	844	0.209	0.190	G5ED03_CAEEL Putative Rho guanine nucleotide exchange factor FGD-1 OS=Caenorhabditis elegans OX=6239 GN=fgd-1 PE=2 SV=1
16	Q54DW7	2.76e-44	174	986	0.161	0.125	Q54DW7_DICDI Pleckstrin domain-containing protein OS=Dictyostelium discoideum OX=44689 GN=gxcU PE=4 SV=1
17	O94887	1.54e-43	172	1054	0.206	0.150	FARP2_HUMAN FERM, ARHGEF and pleckstrin domain-containing protein 2 OS=Homo sapiens OX=9606 GN=FARP2 PE=1 SV=3
18	Q91VS8	3.14e-40	162	1065	0.159	0.115	FARP2_MOUSE FERM, ARHGEF and pleckstrin domain-containing protein 2 OS=Mus musculus OX=10090 GN=Farp2 PE=1 SV=2
19	Q9Y4F1	3.44e-40	162	1045	0.180	0.132	FARP1_HUMAN FERM, ARHGEF and pleckstrin domain-containing protein 1 OS=Homo sapiens OX=9606 GN=FARP1 PE=1 SV=1
20	F1LYQ8	9.45e-40	160	1049	0.183	0.133	FARP1_RAT FERM, ARHGEF and pleckstrin domain-containing protein 1 OS=Rattus norvegicus OX=10116 GN=Farp1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF10167 BORCS8	3.1e+02	12.7	BLOC-1-related complex sub-unit 8
2	PF01363 FYVE	5.1e-15	66.7	FYVE zinc finger
3	PF02318 FYVE_2	0.065	24.8	FYVE-type zinc finger
4	PF16453 IQ_SEC7_PH	0.0011	30.3	PH domain
5	PF12814 Mcp5_PH	3.6e+02	12.8	Meiotic cell cortex C-terminal pleckstrin homology
6	PF00169 PH	3.4e-21	87.1	PH domain
7	PF15413 PH_11	2.6e+02	13.5	Pleckstrin homology domain
8	PF16652 PH_13	0.078	24.4	Pleckstrin homology domain
9	PF08458 PH_2	42	15.9	Plant pleckstrin homology-like region
10	PF15405 PH_5	2.2e+02	13.4	Pleckstrin homology domain
11	PF15406 PH_6	0.56	21.9	Pleckstrin homology domain
12	PF00621 RhoGEF	9.4e-43	158.1	RhoGEF domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000394487

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000256190	0.811	Myotubularin-related protein 13
2	9606.ENSP00000423660	0.793	SH3 domain and tetratricopeptide repeats 2
3	9606.ENSP00000345752	0.769	Myotubularin-related protein 2
4	9606.ENSP00000230124	0.694	Polyphosphoinositide phosphatase
5	9606.ENSP00000220822	0.683	Ganglioside-induced differentiation-associated protein 1
6	9606.ENSP00000383118	0.679	Cell division control protein 42 homolog
7	9606.ENSP00000370196	0.665	Myotubularin-related protein 5
8	9606.ENSP00000480763	0.620	Ephrin type-A receptor 5
9	9606.ENSP00000322937	0.609	E3 ubiquitin-protein ligase LRSAM1
10	9606.ENSP00000249071	0.583	Ras-related C3 botulinum toxin substrate 2
11	9606.ENSP00000459533	0.567	Lipopolysaccharide-induced tumor necrosis factor-alpha factor
12	9606.ENSP00000432943	0.566	Myelin protein P0
13	9606.ENSP00000376410	0.564	Inverted formin-2
14	9606.ENSP00000298815	0.559	Rho GTPase-activating protein 42
15	9606.ENSP00000404854	0.552	Protein NDRG1
16	9606.ENSP00000261776	0.540	Protein VAC14 homolog
17	9606.ENSP00000315659	0.536	Dynamin-binding protein
18	9606.ENSP00000263934	0.529	Kinesin-like protein KIF1B
19	9606.ENSP00000298694	0.523	Rho guanine nucleotide exchange factor 40
20	9606.ENSP00000363134	0.504	Gap junction beta-1 protein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005085	1.000	guanyl-nucleotide exchange factor activity
GO:0008092	0.998	cytoskeletal protein binding
GO:0003779	0.763	actin binding
GO:0044877	0.742	protein-containing complex binding
GO:0051015	0.564	actin filament binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.990	regulation of cellular process
GO:0048583	0.971	regulation of response to stimulus
GO:0023051	0.971	regulation of signaling
GO:0010646	0.971	regulation of cell communication
GO:1902531	0.948	regulation of intracellular signal transduction
GO:0009987	0.911	cellular process
GO:0051056	0.758	regulation of small GTPase mediated signal transduction
GO:0071840	0.580	cellular component organization or biogenesis
GO:0016043	0.534	cellular component organization
GO:0048518	0.409	positive regulation of biological process
GO:0048522	0.353	positive regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0005829	0.991	cytosol
GO:0043226	0.832	organelle
GO:0043227	0.658	membrane-bounded organelle
GO:0043231	0.465	intracellular membrane-bounded organelle
GO:0016020	0.403	membrane
GO:0042995	0.318	cell projection
GO:0120025	0.304	plasma membrane bounded cell projection

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]