StarFunc result for job id Q96MA1

User Input

>input (342 residues)
MADKMVRTPKCSRCRNHGFLVPVKGHAGKCRWKQCLCEKCYLISERQKIMAAQKVLKTQA
AEEEQEAALCAQGPKQASGAAAAAPAPVPVPAASLRPLSPGTPSGDADPGPEGRAAACFF
EQPPRGRNPGPRALQPVLGGRSHVEPSERAAVAMPSLAGPPFGAEAAGSGYPGPLDLRRP
MRTVPGPLFTDFVRPLNINPDRALGPEYPGGSSMHPYCPFPLGYLDAPPGVPLQQGFRHV
SRSQYQGGGLVSEPGGDFQPSYYLPPPPPPLPPLPPLPPQPQFLPPGYLSALHFLPPPPP
PPPPSSFSLTVLFDTDKENTDDQDAEVLSGEPSQPSSQEQSD

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q96MA1	0.998	0.998	1.917E-50	342	1.000	1.000	Q96MA1.pdb.gz	DMRTB_HUMAN Doublesex- and mab-3-related transcription factor B1 OS=Homo sapiens OX=9606 GN=DMRTB1 PE=1 SV=1
2	AFDB:A2A9I7	0.212	0.204	2.064E-20	359	0.553	0.526	A2A9I7.pdb.gz	DMRTB_MOUSE Doublesex- and mab-3-related transcription factor B1 OS=Mus musculus OX=10090 GN=Dmrtb1 PE=1 SV=1
3	AFDB:Q9Y5R6	0.187	0.172	7.528E-7	373	0.257	0.236	Q9Y5R6.pdb.gz	DMRT1_HUMAN Doublesex- and mab-3-related transcription factor 1 OS=Homo sapiens OX=9606 GN=DMRT1 PE=1 SV=2
4	AFDB:Q925A6	0.186	0.171	1.709E-6	374	0.234	0.214	Q925A6.pdb.gz	Q925A6_RAT Doublesex and mab-3 related transcription factor 1 OS=Rattus norvegicus OX=10116 GN=Dmrt1 PE=3 SV=1
5	AFDB:P23023	0.198	0.128	2.246E-6	549	0.190	0.118	P23023.pdb.gz	DSX_DROME Protein doublesex OS=Drosophila melanogaster OX=7227 GN=dsx PE=1 SV=1
6	AFDB:Q3LH63	0.188	0.192	3.624E-6	336	0.216	0.220	Q3LH63.pdb.gz	DMT1A_XENLA Doublesex- and mab-3-related transcription factor 1A OS=Xenopus laevis OX=8355 GN=dmrt1-a PE=1 SV=1
7	AFDB:Q9PTQ7	0.187	0.175	5.461E-6	365	0.249	0.233	Q9PTQ7.pdb.gz	DMRT1_CHICK Doublesex- and mab-3-related transcription factor 1 OS=Gallus gallus OX=9031 GN=DMRT1 PE=2 SV=2
8	AFDB:Q8CGW9	0.212	0.197	7.178E-6	370	0.249	0.230	Q8CGW9.pdb.gz	DMRTD_MOUSE Doublesex- and mab-3-related transcription factor C2 OS=Mus musculus OX=10090 GN=Dmrtc2 PE=2 SV=1
9	AFDB:Q8IXT2	0.210	0.196	4.542E-5	367	0.231	0.215	Q8IXT2.pdb.gz	DMRTD_HUMAN Doublesex- and mab-3-related transcription factor C2 OS=Homo sapiens OX=9606 GN=DMRTC2 PE=2 SV=2
10	AFDB:Q9W3Q5	0.111	0.037	2.327E-1	1268	0.129	0.035	Q9W3Q5.pdb.gz	Q9W3Q5_DROME Checkpoint suppressor 1-like, isoform A OS=Drosophila melanogaster OX=7227 GN=CHES-1-like PE=4 SV=4
11	PDB:7mqaSS	0.082	0.080	7.811	350	0.044	0.043	7mqaSS.pdb.gz	Nucleolar maturation of the human small subunit processome.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q96MA1	0.0	672	342	1.000	1.000	DMRTB_HUMAN Doublesex- and mab-3-related transcription factor B1 OS=Homo sapiens OX=9606 GN=DMRTB1 PE=1 SV=1
2	I6L9A0	1.02e-127	365	189	0.553	1.000	I6L9A0_HUMAN DMRT-like family B with proline-rich C-terminal 1 isoform 1 OS=Homo sapiens OX=9606 GN=DMRTB1 PE=1 SV=1
3	A2A9I7	2.06e-60	199	359	0.532	0.507	DMRTB_MOUSE Doublesex- and mab-3-related transcription factor B1 OS=Mus musculus OX=10090 GN=Dmrtb1 PE=1 SV=1
4	Q96SC8	5.74e-22	99.0	542	0.120	0.076	DMTA2_HUMAN Doublesex- and mab-3-related transcription factor A2 OS=Homo sapiens OX=9606 GN=DMRTA2 PE=2 SV=2
5	Q5UU75	7.31e-22	97.8	440	0.143	0.111	DMTA2_DANRE Doublesex- and mab-3-related transcription factor A2 OS=Danio rerio OX=7955 GN=dmrta2 PE=2 SV=1
6	Q2MJB4	8.27e-22	97.8	437	0.117	0.092	DMTA2_XENLA Doublesex- and mab-3-related transcription factor A2 OS=Xenopus laevis OX=8355 GN=dmrta2 PE=2 SV=1
7	A2A9A2	2.55e-21	97.1	531	0.117	0.075	DMTA2_MOUSE Doublesex- and mab-3-related transcription factor A2 OS=Mus musculus OX=10090 GN=Dmrta2 PE=2 SV=1
8	Q71MM5	6.81e-21	92.8	267	0.111	0.142	DMRT1_DANRE Doublesex- and mab-3-related transcription factor 1 OS=Danio rerio OX=7955 GN=dmrt1 PE=2 SV=1
9	Q19291	1.69e-20	92.0	280	0.105	0.129	DMD5_CAEEL Doublesex- and mab-3-related transcription factor dmd-5 OS=Caenorhabditis elegans OX=6239 GN=dmd-5 PE=1 SV=2
10	Q8CFG4	2.77e-20	93.6	490	0.149	0.104	DMRTA_MOUSE Doublesex- and mab-3-related transcription factor A1 OS=Mus musculus OX=10090 GN=Dmrta1 PE=2 SV=1
11	Q5VZB9	1.45e-19	91.7	504	0.108	0.073	DMRTA_HUMAN Doublesex- and mab-3-related transcription factor A1 OS=Homo sapiens OX=9606 GN=DMRTA1 PE=1 SV=1
12	Q8JIR6	7.62e-19	87.0	267	0.117	0.150	DMT1Y_ORYLA Doublesex- and mab-3-related transcription factor 1Y OS=Oryzias latipes OX=8090 GN=dmrt1y PE=2 SV=1
13	Q80WT2	8.78e-19	89.4	476	0.108	0.078	DMRT3_MOUSE Doublesex- and mab-3-related transcription factor 3 OS=Mus musculus OX=10090 GN=Dmrt3 PE=2 SV=2
14	Q9NQL9	8.99e-19	89.0	472	0.108	0.078	DMRT3_HUMAN Doublesex- and mab-3-related transcription factor 3 OS=Homo sapiens OX=9606 GN=DMRT3 PE=1 SV=1
15	F6W2R2	9.76e-19	89.0	474	0.108	0.078	DMRT3_HORSE Doublesex and mab-3 related transcription factor 3 OS=Equus caballus OX=9796 GN=DMRT3 PE=2 SV=2
16	J7FCF0	1.20e-18	87.0	300	0.108	0.123	DMR3T_HORSE Doublesex and mab-3 related transcription factor 3, truncated OS=Equus caballus OX=9796 GN=DMRT3 PE=2 SV=1
17	P83758	1.28e-18	88.6	448	0.108	0.083	DMT3A_DANRE Doublesex- and mab-3-related transcription factor 3a OS=Danio rerio OX=7955 GN=dmrt3a PE=1 SV=2
18	Q3LH63	1.34e-18	87.4	336	0.099	0.101	DMT1A_XENLA Doublesex- and mab-3-related transcription factor 1A OS=Xenopus laevis OX=8355 GN=dmrt1-a PE=1 SV=1
19	Q925A6	1.65e-18	87.8	374	0.099	0.091	Q925A6_RAT Doublesex and mab-3 related transcription factor 1 OS=Rattus norvegicus OX=10116 GN=Dmrt1 PE=3 SV=1
20	Q9QZ59	1.82e-18	87.4	374	0.099	0.091	DMRT1_MOUSE Doublesex- and mab-3-related transcription factor 1 OS=Mus musculus OX=10090 GN=Dmrt1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00751 DM	3.7e-18	76.5	DM DNA binding domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000360500

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000290921	0.684	C-terminal-binding protein 1
2	9606.ENSP00000332225	0.592	Pro-MCH
3	9606.ENSP00000379946	0.556	BRD4-interacting chromatin-remodeling complex-associated protein
4	9606.ENSP00000479281	0.556	Uncharacterized protein LOC400658
5	9606.ENSP00000327786	0.538	Izumo sperm-egg fusion protein 1
6	9606.ENSP00000263433	0.532	Protein phosphatase 1 regulatory subunit 12C
7	9606.ENSP00000299320	0.531	Uncharacterized protein C16orf71
8	9606.ENSP00000157600	0.521	LIM and cysteine-rich domains protein 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:1901363	0.722	heterocyclic compound binding
GO:0097159	0.722	organic cyclic compound binding
GO:0003677	0.536	DNA binding
GO:0042802	0.431	identical protein binding
GO:0140110	0.417	transcription regulator activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0032501	0.968	multicellular organismal process
GO:0050789	0.967	regulation of biological process
GO:0048856	0.963	anatomical structure development
GO:0050794	0.938	regulation of cellular process
GO:0019222	0.892	regulation of metabolic process
GO:0009889	0.777	regulation of biosynthetic process
GO:0048518	0.757	positive regulation of biological process
GO:0060255	0.753	regulation of macromolecule metabolic process
GO:0009987	0.749	cellular process
GO:0080090	0.716	regulation of primary metabolic process
GO:0051171	0.716	regulation of nitrogen compound metabolic process
GO:0000003	0.715	reproduction
GO:0031323	0.715	regulation of cellular metabolic process
GO:0010468	0.689	regulation of gene expression
GO:0019219	0.669	regulation of nucleobase-containing compound metabolic process
GO:0031326	0.641	regulation of cellular biosynthetic process
GO:0051252	0.641	regulation of RNA metabolic process
GO:0010556	0.640	regulation of macromolecule biosynthetic process
GO:0003006	0.613	developmental process involved in reproduction
GO:2001141	0.552	regulation of RNA biosynthetic process
GO:0006355	0.530	regulation of DNA-templated transcription
GO:0048522	0.510	positive regulation of cellular process
GO:0007275	0.445	multicellular organism development
GO:0009893	0.435	positive regulation of metabolic process
GO:0051173	0.421	positive regulation of nitrogen compound metabolic process
GO:0010604	0.415	positive regulation of macromolecule metabolic process
GO:0031325	0.314	positive regulation of cellular metabolic process
GO:0048731	0.308	system development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0070013	0.731	intracellular organelle lumen
GO:0031981	0.717	nuclear lumen
GO:0032991	0.518	protein-containing complex
GO:0005654	0.453	nucleoplasm
GO:0043232	0.320	intracellular non-membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]