StarFunc result for job id Q96MA6

User Input

>input (479 residues)
MDATIAPHRIPPEMPQYGEENHIFELMQNMLEQLLIHQPEDPIPFMIQHLHRDNDNVPRI
VILGPPASGKTTIAMWLCKHLNSSLLTLENLILNEFSYTATEARRLYLQRKTVPSALLVQ
LIQERLAEEDCIKQGWILDGIPETREQALRIQTLGITPRHVIVLSAPDTVLIERNLGKRI
DPQTGEIYHTTFDWPPESEIQNRLMVPEDISELETAQKLLEYHRNIVRVIPSYPKILKVI
SADQPCVDVFYQALTYVQSNHRTNAPFTPRVLLLGPVGSGKSLQAALLAQKYRLVNVCCG
QLLKEAVADRTTFGELIQPFFEKEMAVPDSLLMKVLSQRLDQQDCIQKGWVLHGVPRDLD
QAHLLNRLGYNPNRVFFLNVPFDSIMERLTLRRIDPVTGERYHLMYKPPPTMEIQARLLQ
NPKDAEEQVKLKMDLFYRNSADLEQLYGSAITLNGDQDPYTVFEYIESGIINPLPKKIP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q96MA6	1.000	1.000	1.993E-92	479	1.000	1.000	Q96MA6.pdb.gz	KAD8_HUMAN Adenylate kinase 8 OS=Homo sapiens OX=9606 GN=AK8 PE=1 SV=1
2	AFDB:Q32M07	0.925	0.925	6.934E-78	479	0.770	0.770	Q32M07.pdb.gz	KAD8_MOUSE Adenylate kinase 8 OS=Mus musculus OX=10090 GN=Ak8 PE=1 SV=1
3	AFDB:A0A4X1T4U3	0.875	0.845	7.200E-76	498	0.795	0.765	A0A4X1T4U3.pdb.gz	KAD8_PIG Adenylate kinase 8 OS=Sus scrofa OX=9823 GN=AK8 PE=1 SV=2
4	AFDB:Q9Y6K8	0.333	0.286	7.858E-22	562	0.192	0.164	Q9Y6K8.pdb.gz	KAD5_HUMAN Adenylate kinase isoenzyme 5 OS=Homo sapiens OX=9606 GN=AK5 PE=1 SV=2
5	AFDB:A5PMF1	0.346	0.300	2.100E-21	563	0.182	0.155	A5PMF1.pdb.gz	A5PMF1_DANRE Adenylate kinase 5 OS=Danio rerio OX=7955 GN=wu:fj63a06 PE=1 SV=1
6	AFDB:Q9FIJ7	0.377	0.615	5.879E-20	283	0.157	0.265	Q9FIJ7.pdb.gz	KAD2_ARATH Adenylate kinase 2, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=At5g47840 PE=1 SV=1
7	AFDB:Q57U69	0.442	0.776	1.263E-19	260	0.154	0.285	Q57U69.pdb.gz	Q57U69_TRYB2 Adenylate kinase, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb05.6E7.1020 PE=3 SV=1
8	AFDB:Q8VYL1	0.418	0.349	1.660E-19	588	0.171	0.139	Q8VYL1.pdb.gz	KAD5_ARATH Adenylate kinase 5, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=At5g35170 PE=1 SV=1
9	AFDB:Q38CF7	0.426	0.744	1.753E-19	260	0.154	0.285	Q38CF7.pdb.gz	Q38CF7_TRYB2 Adenylate kinase, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.70.7330 PE=3 SV=1
10	AFDB:Q586D5	0.434	0.763	5.226E-19	260	0.129	0.238	Q586D5.pdb.gz	Q586D5_TRYB2 Adenylate kinase, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=1F7.200 PE=3 SV=1
11	PDB:3tlxB	0.367	0.693	1.333E-14	240	0.123	0.246	3tlxB.pdb.gz	Crystal Structure of PF10_0086, adenylate kinase from plasmodium falciparum
12	PDB:2c9yA	0.364	0.742	1.659E-14	218	0.109	0.239	2c9yA.pdb.gz	Structure of Human Adenylate Kinase 2
13	PDB:1akeA	0.354	0.740	1.322E-13	214	0.115	0.257	1akeA.pdb.gz	Structure of the complex between adenylate kinase from Escherichia coli and the inhibitor Ap5A refined at 1.9 A resolution. A model for a catalytic transition state.
14	PDB:2ar7A	0.349	0.692	3.167E-13	221	0.119	0.258	2ar7A.pdb.gz
15	PDB:1dvrA	0.386	0.799	4.396E-13	220	0.111	0.241	1dvrA.pdb.gz	Structure of a mutant adenylate kinase ligated with an ATP-analogue showing domain closure over ATP.
16	PDB:6zjbD	0.360	0.730	1.631E-12	218	0.119	0.261	6zjbD.pdb.gz	Structural Basis for GTP versus ATP Selectivity in the NMP Kinase AK3.
17	PDB:7sqcC2	0.361	0.126	8.791E-11	1498	0.154	0.049	7sqcC2.pdb.gz	Ciliary central apparatus structure reveals mechanisms of microtubule patterning.
18	PDB:2cdnA	0.316	0.759	1.094E-10	186	0.104	0.269	2cdnA.pdb.gz	The Crystal Structure of Mycobacterium Tuberculosis Adenylate Kinase in Complex with Two Molecules of Adp and Mg2+ Supports an Associative Mechanism for Phosphoryl Transfer.
19	PDB:3ndpB	0.304	0.651	2.482E-10	206	0.119	0.277	3ndpB.pdb.gz
20	PDB:2c95A	0.322	0.739	4.057E-10	195	0.081	0.200	2c95A.pdb.gz	Structure of Adenylate Kinase 1 in Complex with P1, P4-Di(Adenosine)Tetraphosphate

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A4X1T4U3	0.0	809	479	0.795	0.795	KAD8_PIG Adenylate kinase 8 OS=Sus scrofa OX=9823 GN=AK8 PE=1 SV=2
2	Q32M07	0.0	796	479	0.770	0.770	KAD8_MOUSE Adenylate kinase 8 OS=Mus musculus OX=10090 GN=Ak8 PE=1 SV=1
3	Q96MA6	0.0	985	479	1.000	1.000	KAD8_HUMAN Adenylate kinase 8 OS=Homo sapiens OX=9606 GN=AK8 PE=1 SV=1
4	Q9FIJ7	8.69e-40	147	283	0.157	0.265	KAD2_ARATH Adenylate kinase 2, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=At5g47840 PE=1 SV=1
5	Q57U69	1.55e-34	132	260	0.163	0.300	Q57U69_TRYB2 Adenylate kinase, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb05.6E7.1020 PE=3 SV=1
6	Q8VYL1	3.78e-33	134	588	0.138	0.112	KAD5_ARATH Adenylate kinase 5, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=At5g35170 PE=1 SV=1
7	Q38CF7	9.99e-29	116	260	0.154	0.285	Q38CF7_TRYB2 Adenylate kinase, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.70.7330 PE=3 SV=1
8	Q586D5	1.09e-27	113	260	0.140	0.258	Q586D5_TRYB2 Adenylate kinase, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=1F7.200 PE=3 SV=1
9	Q97SU1	7.34e-26	107	212	0.136	0.307	KAD_STRPN Adenylate kinase OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=adk PE=1 SV=1
10	Q38B28	2.76e-24	102	215	0.119	0.265	Q38B28_TRYB2 Adenylate kinase, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.70.1200 PE=3 SV=1
11	Q38BZ2	2.84e-22	97.1	222	0.123	0.266	Q38BZ2_TRYB2 Adenylate kinase, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.70.5150 PE=3 SV=1
12	P69441	2.26e-21	94.4	214	0.113	0.252	KAD_ECOLI Adenylate kinase OS=Escherichia coli (strain K12) OX=83333 GN=adk PE=1 SV=1
13	Q9WUS0	3.25e-21	94.4	223	0.117	0.251	KAD4_RAT Adenylate kinase 4, mitochondrial OS=Rattus norvegicus OX=10116 GN=Ak4 PE=2 SV=1
14	P27144	7.16e-21	93.2	223	0.119	0.256	KAD4_HUMAN Adenylate kinase 4, mitochondrial OS=Homo sapiens OX=9606 GN=AK4 PE=1 SV=1
15	Q08480	1.11e-20	93.2	243	0.117	0.230	KAD4_ORYSJ Adenylate kinase 4 OS=Oryza sativa subsp. japonica OX=39947 GN=ADK-B PE=2 SV=1
16	Q9WUR9	1.65e-20	92.0	223	0.119	0.256	KAD4_MOUSE Adenylate kinase 4, mitochondrial OS=Mus musculus OX=10090 GN=Ak4 PE=1 SV=1
17	Q9FK35	4.25e-20	91.7	248	0.106	0.206	KAD3_ARATH Adenylate kinase 3 OS=Arabidopsis thaliana OX=3702 GN=ADK2 PE=1 SV=1
18	O82514	6.20e-20	91.3	246	0.123	0.240	KAD4_ARATH Adenylate kinase 4 OS=Arabidopsis thaliana OX=3702 GN=ADK1 PE=1 SV=2
19	Q9UIJ7	1.29e-19	89.7	227	0.100	0.211	KAD3_HUMAN GTP:AMP phosphotransferase AK3, mitochondrial OS=Homo sapiens OX=9606 GN=AK3 PE=1 SV=4
20	Q9WTP7	1.73e-19	89.4	227	0.113	0.238	KAD3_MOUSE GTP:AMP phosphotransferase AK3, mitochondrial OS=Mus musculus OX=10090 GN=Ak3 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01591 6PF2K	2.1e+02	12.6	6-phosphofructo-2-kinase
2	PF00004 AAA	0.00079	31.3	ATPase family associated with various cellular activities (AAA)
3	PF13173 AAA_14	1.9e+02	13.5	AAA domain
4	PF13191 AAA_16	0.026	26.4	AAA ATPase domain
5	PF13207 AAA_17	9.9e-19	79.5	AAA domain
6	PF13238 AAA_18	2.6e-08	45.9	AAA domain
7	PF13401 AAA_22	11	17.7	AAA domain
8	PF13479 AAA_24	35	15.6	AAA domain
9	PF13521 AAA_28	3.7	19.2	AAA domain
10	PF13555 AAA_29	23	16.2	P-loop containing region of AAA domain
11	PF13671 AAA_33	0.00094	30.8	AAA domain
12	PF07728 AAA_5	0.18	23.3	AAA domain (dynein-related subfamily)
13	PF12775 AAA_7	2.5e+02	12.6	P-loop containing dynein motor region
14	PF00005 ABC_tran	2.1	20.3	ABC transporter
15	PF00406 ADK	4.8e-38	142.1	Adenylate kinase
16	PF05191 ADK_lid	4.8e+02	12.1	Adenylate kinase, active site lid
17	PF02492 cobW	1.2e+02	13.7	CobW/HypB/UreG, nucleotide-binding domain
18	PF02224 Cytidylate_kin	53	15.0	Cytidylate kinase
19	PF01712 dNK	5.4	18.4	Deoxynucleoside kinase
20	PF17819 DUF5582	16	17.4	Family of unknown function (DUF5582)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000298545

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000286621	0.957	Adenosine kinase
2	9606.ENSP00000367615	0.942	Adenine phosphoribosyltransferase
3	9606.ENSP00000347213	0.929	Ectonucleoside triphosphate diphosphohydrolase 2
4	9606.ENSP00000485525	0.919	Adenylosuccinate lyase
5	9606.ENSP00000300738	0.917	Ribonucleoside-diphosphate reductase large subunit
6	9606.ENSP00000286648	0.906	Deoxycytidine kinase
7	9606.ENSP00000353165	0.905	Thiamin pyrophosphokinase 1
8	9606.ENSP00000251810	0.902	Ribonucleoside-diphosphate reductase subunit M2 B
9	9606.ENSP00000353770	0.902	Ribonucleoside-diphosphate reductase subunit M2
10	9606.ENSP00000355587	0.900	Cancer-related nucleoside-triphosphatase
11	9606.ENSP00000267584	0.873	Adenylate kinase 7
12	9606.ENSP00000410186	0.850	Adenylate kinase 9
13	9606.ENSP00000356785	0.810	Nucleoside diphosphate kinase 7
14	9606.ENSP00000360757	0.760	Protein FAM69B
15	9606.ENSP00000219302	0.752	Nucleoside diphosphate kinase 3
16	9606.ENSP00000219479	0.752	Nucleoside diphosphate kinase, mitochondrial
17	9606.ENSP00000337060	0.752	Nucleoside diphosphate kinase A
18	9606.ENSP00000376886	0.752	Major role in the synthesis of nucleoside triphosphates other than ATP. The ATP gamma phosphate is transferred to the NDP beta phosphate via a ping-pong mechanism, using a phosphorylated active-site intermediate (By similarity). Negatively regulates Rho activity by interacting with AKAP13/LBC . Acts as a transcriptional activator of the MYC gene
19	9606.ENSP00000376889	0.752	Nucleoside diphosphate kinase
20	9606.ENSP00000416658	0.752	Nucleoside diphosphate kinase 6

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004017	1.000	adenylate kinase activity
GO:0004550	0.999	nucleoside diphosphate kinase activity
GO:0016208	0.995	AMP binding
GO:0004127	0.431	cytidylate kinase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.996	organic substance metabolic process
GO:0044238	0.996	primary metabolic process
GO:0044237	0.996	cellular metabolic process
GO:0006753	0.990	nucleoside phosphate metabolic process
GO:0034654	0.989	nucleobase-containing compound biosynthetic process
GO:1901293	0.981	nucleoside phosphate biosynthetic process
GO:0009117	0.974	nucleotide metabolic process
GO:0009132	0.958	nucleoside diphosphate metabolic process
GO:0046939	0.698	nucleotide phosphorylation
GO:0009141	0.543	nucleoside triphosphate metabolic process
GO:0009142	0.506	nucleoside triphosphate biosynthetic process
GO:0006165	0.505	nucleoside diphosphate phosphorylation
GO:1901564	0.385	organonitrogen compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043227	1.000	membrane-bounded organelle
GO:0005737	1.000	cytoplasm
GO:0031514	0.986	motile cilium
GO:0005829	0.985	cytosol
GO:0097729	0.955	9+2 motile cilium
GO:0043229	0.948	intracellular organelle
GO:0043232	0.940	intracellular non-membrane-bounded organelle
GO:0043231	0.676	intracellular membrane-bounded organelle
GO:0005856	0.653	cytoskeleton
GO:0099568	0.349	cytoplasmic region
GO:0097014	0.335	ciliary plasm
GO:0005930	0.303	axoneme

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:12973	1.000	AMP + ATP = 2 ADP
EC:2.7.4.3	1.000	adenylate kinase.
EC:2.7.4.6	0.999	nucleoside-diphosphate kinase.
EC:2.7.4.14	0.431	UMP/CMP kinase.

[back to server]