StarFunc result for job id Q96MC5

User Input

>input (204 residues)
MELKQSLSTHLEAEKPLRRYGAVEETAWKTERLGRNQLDIISMAETTMMPEEIELEMAKI
QRLREVLVRRESELRFMMDDIQLCKDIMDLKQELQNLVAIPEKEKTKLQKQREDELIQKI
HKLVQKRDFLVDDAEVERLREQEEDKEMADFLRIKLKPLDKVTKSPASSRAEKKAEPPPS
KPTVAKTGLALIKDCCGATQCNIM

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q96MC5	1.000	1.000	3.103E-30	204	1.000	1.000	Q96MC5.pdb.gz	MERB1_HUMAN bMERB domain-containing protein 1 OS=Homo sapiens OX=9606 GN=BMERB1 PE=1 SV=1
2	AFDB:Q8BGT6	0.446	0.117	2.513E-3	870	0.196	0.046	Q8BGT6.pdb.gz	MILK1_MOUSE MICAL-like protein 1 OS=Mus musculus OX=10090 GN=Micall1 PE=1 SV=3
3	AFDB:Q8IY33	0.444	0.108	3.250E-3	904	0.196	0.044	Q8IY33.pdb.gz	MILK2_HUMAN MICAL-like protein 2 OS=Homo sapiens OX=9606 GN=MICALL2 PE=1 SV=1
4	AFDB:F1RA39	0.491	0.076	3.466E-3	1413	0.142	0.021	F1RA39.pdb.gz	MCA2B_DANRE [F-actin]-monooxygenase mical2b OS=Danio rerio OX=7955 GN=mical2b PE=2 SV=3
5	AFDB:Q69ZW3	0.526	0.102	3.696E-3	1231	0.216	0.036	Q69ZW3.pdb.gz	EHBP1_MOUSE EH domain-binding protein 1 OS=Mus musculus OX=10090 GN=Ehbp1 PE=1 SV=3
6	AFDB:Q8N3F8	0.471	0.123	4.203E-3	863	0.172	0.041	Q8N3F8.pdb.gz	MILK1_HUMAN MICAL-like protein 1 OS=Homo sapiens OX=9606 GN=MICALL1 PE=1 SV=2
7	AFDB:Q3TN34	0.406	0.085	7.495E-3	1009	0.181	0.037	Q3TN34.pdb.gz	MILK2_MOUSE MICAL-like protein 2 OS=Mus musculus OX=10090 GN=Micall2 PE=1 SV=1
8	AFDB:D3ZEN0	0.443	0.098	9.692E-3	1014	0.196	0.039	D3ZEN0.pdb.gz	MILK2_RAT MICAL-like protein 2 OS=Rattus norvegicus OX=10116 GN=Micall2 PE=1 SV=2
9	AFDB:Q8NDI1	0.519	0.094	1.175E-2	1231	0.186	0.031	Q8NDI1.pdb.gz	EHBP1_HUMAN EH domain-binding protein 1 OS=Homo sapiens OX=9606 GN=EHBP1 PE=1 SV=3
10	AFDB:Q8N3D4	0.499	0.073	2.710E-2	1523	0.152	0.020	Q8N3D4.pdb.gz	EH1L1_HUMAN EH domain-binding protein 1-like protein 1 OS=Homo sapiens OX=9606 GN=EHBP1L1 PE=1 SV=2
11	PDB:6tuyA	0.374	0.120	1.330E-1	667	0.054	0.016	6tuyA.pdb.gz	Novel non-covalent LSD1 inhibitors endowed with anticancer effects in leukemia and solid tumor cellular models.
12	PDB:4n78F	0.213	0.272	3.720E-1	156	0.074	0.096	4n78F.pdb.gz	The WAVE Regulatory Complex Links Diverse Receptors to the Actin Cytoskeleton.
13	PDB:7z37DP1	0.323	0.248	3.720E-1	273	0.078	0.059	7z37DP1.pdb.gz	Structure of the RAF1-HSP90-CDC37 complex reveals the basis of RAF1 regulation.
14	PDB:2zdiB	0.371	0.669	3.967E-1	106	0.064	0.123	2zdiB.pdb.gz
15	PDB:5svaU	0.224	0.263	6.634E-1	156	0.132	0.173	5svaU.pdb.gz	Structure of a Complete Mediator-RNA Polymerase II Pre-Initiation Complex.
16	PDB:7ungi	0.250	0.205	7.075E-1	250	0.088	0.072	7ungi.pdb.gz	SPACA9 is a lumenal protein of human ciliary singlet and doublet microtubules.
17	PDB:7vvuV	0.261	0.404	9.149E-1	113	0.078	0.142	7vvuV.pdb.gz	Structure of the NuA4 acetyltransferase complex bound to the nucleosome.
18	PDB:6so5C	0.306	0.400	9.756E-1	144	0.078	0.111	6so5C.pdb.gz	Structural Basis of Tail-Anchored Membrane Protein Biogenesis by the GET Insertase Complex.
19	PDB:7v2wJ	0.274	0.241	1.183	236	0.074	0.064	7v2wJ.pdb.gz
20	PDB:3jcfA	0.274	0.176	1.631	349	0.069	0.040	3jcfA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q96MC5	1.19e-146	407	204	1.000	1.000	MERB1_HUMAN bMERB domain-containing protein 1 OS=Homo sapiens OX=9606 GN=BMERB1 PE=1 SV=1
2	Q8R1Y2	1.62e-137	384	203	0.951	0.956	MERB1_MOUSE bMERB domain-containing protein 1 OS=Mus musculus OX=10090 GN=Bmerb1 PE=1 SV=1
3	D3ZEN0	1.53e-09	58.9	1014	0.162	0.033	MILK2_RAT MICAL-like protein 2 OS=Rattus norvegicus OX=10116 GN=Micall2 PE=1 SV=2
4	Q3TN34	2.89e-09	58.2	1009	0.172	0.035	MILK2_MOUSE MICAL-like protein 2 OS=Mus musculus OX=10090 GN=Micall2 PE=1 SV=1
5	Q8IY33	5.55e-08	54.3	904	0.157	0.035	MILK2_HUMAN MICAL-like protein 2 OS=Homo sapiens OX=9606 GN=MICALL2 PE=1 SV=1
6	A0A140VK17	4.75e-04	42.7	1196	0.137	0.023	A0A140VK17_HUMAN EH domain binding protein 1, isoform CRA_a OS=Homo sapiens OX=9606 GN=EHBP1 PE=2 SV=1
7	Q8TDZ2	4.78e-04	42.7	1067	0.172	0.033	MICA1_HUMAN [F-actin]-monooxygenase MICAL1 OS=Homo sapiens OX=9606 GN=MICAL1 PE=1 SV=2
8	Q8BGT6	5.29e-04	42.7	870	0.123	0.029	MILK1_MOUSE MICAL-like protein 1 OS=Mus musculus OX=10090 GN=Micall1 PE=1 SV=3
9	Q8NDI1	5.37e-04	42.7	1231	0.137	0.023	EHBP1_HUMAN EH domain-binding protein 1 OS=Homo sapiens OX=9606 GN=EHBP1 PE=1 SV=3
10	Q69ZW3	6.27e-04	42.4	1231	0.137	0.023	EHBP1_MOUSE EH domain-binding protein 1 OS=Mus musculus OX=10090 GN=Ehbp1 PE=1 SV=3
11	D3ZQL6	6.29e-04	42.4	855	0.123	0.029	MILK1_RAT MICAL-like protein 1 OS=Rattus norvegicus OX=10116 GN=Micall1 PE=1 SV=1
12	E1BBG2	7.35e-04	42.0	853	0.118	0.028	MILK1_BOVIN MICAL-like protein 1 OS=Bos taurus OX=9913 GN=MICALL1 PE=1 SV=2
13	O94851	0.001	41.6	1957	0.162	0.017	MICA2_HUMAN [F-actin]-monooxygenase MICAL2 OS=Homo sapiens OX=9606 GN=MICAL2 PE=1 SV=2
14	Q8N3F8	0.001	41.6	863	0.113	0.027	MILK1_HUMAN MICAL-like protein 1 OS=Homo sapiens OX=9606 GN=MICALL1 PE=1 SV=2
15	F1RA39	0.008	39.3	1679	0.137	0.017	MCA2B_DANRE [F-actin]-monooxygenase mical2b OS=Danio rerio OX=7955 GN=mical2b PE=2 SV=3
16	Q8N3D4	0.087	35.8	1523	0.118	0.016	EH1L1_HUMAN EH domain-binding protein 1-like protein 1 OS=Homo sapiens OX=9606 GN=EHBP1L1 PE=1 SV=2
17	F1QAZ3	0.18	35.0	783	0.172	0.045	F1QAZ3_DANRE Mical-like 2b OS=Danio rerio OX=7955 GN=MICAL-2 PE=1 SV=2
18	Q06831	0.25	34.3	440	0.152	0.070	SOX4_MOUSE Transcription factor SOX-4 OS=Mus musculus OX=10090 GN=Sox4 PE=1 SV=2
19	P83038	0.38	33.9	1080	0.157	0.030	HDAC4_CHICK Histone deacetylase 4 OS=Gallus gallus OX=9031 GN=HDAC4 PE=2 SV=1
20	Q8VDP3	0.42	33.9	1048	0.118	0.023	MICA1_MOUSE [F-actin]-monooxygenase MICAL1 OS=Mus musculus OX=10090 GN=Mical1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12130 bMERB_dom	3.1e-15	67.9	Bivalent Mical/EHBP Rab binding domain
2	PF17436 DUF5415	4.1e+02	12.4	Family of unknown function (DUF5415)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000300006

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000379654	0.776	Meiosis regulator and mRNA stability factor 1
2	9606.ENSP00000255759	0.772	LisH domain-containing protein FOPNL
3	9606.ENSP00000364649	0.769	Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial
4	9606.ENSP00000252597	0.697	Usher syndrome type-1C protein-binding protein 1
5	9606.ENSP00000282570	0.680	Germ cell-less protein-like 1
6	9606.ENSP00000362728	0.672	Importin subunit alpha-7
7	9606.ENSP00000354791	0.657	Dynactin subunit 1
8	9606.ENSP00000460825	0.586	WSC domain containing 1
9	9606.ENSP00000379643	0.530	Nuclear distribution protein nudE homolog 1
10	9606.ENSP00000364847	0.528	Melanoma-associated antigen D1
11	9606.ENSP00000379669	0.520	Mpv17-like protein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0032886	0.985	regulation of microtubule-based process
GO:0022411	0.985	cellular component disassembly
GO:1902903	0.982	regulation of supramolecular fiber organization
GO:0000226	0.982	microtubule cytoskeleton organization
GO:0021543	0.980	pallium development
GO:0031110	0.976	regulation of microtubule polymerization or depolymerization
GO:0021987	0.974	cerebral cortex development
GO:0043244	0.958	regulation of protein-containing complex disassembly
GO:0051261	0.958	protein depolymerization
GO:1902904	0.958	negative regulation of supramolecular fiber organization
GO:0051494	0.956	negative regulation of cytoskeleton organization
GO:0031109	0.954	microtubule polymerization or depolymerization
GO:0021795	0.953	cerebral cortex cell migration
GO:1901879	0.952	regulation of protein depolymerization
GO:0043242	0.952	negative regulation of protein-containing complex disassembly
GO:0031111	0.952	negative regulation of microtubule polymerization or depolymerization
GO:0042063	0.950	gliogenesis
GO:0021799	0.935	cerebral cortex radially oriented cell migration
GO:0097435	0.932	supramolecular fiber organization
GO:2000145	0.915	regulation of cell motility
GO:0008347	0.913	glial cell migration
GO:1901880	0.911	negative regulation of protein depolymerization
GO:0007019	0.901	microtubule depolymerization
GO:0007026	0.897	negative regulation of microtubule depolymerization
GO:0040013	0.895	negative regulation of locomotion
GO:0030334	0.867	regulation of cell migration
GO:2000146	0.817	negative regulation of cell motility
GO:0030336	0.505	negative regulation of cell migration
GO:0048646	0.406	anatomical structure formation involved in morphogenesis

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0015630	0.998	microtubule cytoskeleton
GO:0043231	0.944	intracellular membrane-bounded organelle
GO:0016020	0.875	membrane
GO:0043233	0.812	organelle lumen
GO:0070013	0.799	intracellular organelle lumen
GO:0005634	0.763	nucleus
GO:0005737	0.751	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]