StarFunc result for job id Q96MF2

User Input

>input (364 residues)
MTEKEVLESPKPSFPAETRQSGLQRLKQLLRKGSTGTKEMELPPEPQANGEAVGAGGGPI
YYIYEEEEEEEEEEEEPPPEPPKLVNDKPHKFKDHFFKKPKFCDVCARMIVLNNKFGLRC
KNCKTNIHEHCQSYVEMQRCFGKIPPGFHRAYSSPLYSNQQYACVKDLSAANRNDPVFET
LRTGVIMANKERKKGQADKKNPVAAMMEEEPESARPEEGKPQDGNPEGDKKAEKKTPDDK
HKQPGFQQSHYFVALYRFKALEKDDLDFPPGEKITVIDDSNEEWWRGKIGEKVGFFPPNF
IIRVRAGERVHRVTRSFVGNREIGQITLKKDQIVVQKGDEAGGYVKVYTGRKVGLFPTDF
LEEI

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A024RB38	0.393	0.393	2.276E-58	364	1.000	1.000	A0A024RB38.pdb.gz
2	AFDB:Q6DBR6	0.523	0.565	4.273E-39	334	0.566	0.617	Q6DBR6.pdb.gz	STAC3_DANRE SH3 and cysteine-rich domain-containing protein 3 OS=Danio rerio OX=7955 GN=stac3 PE=1 SV=1
3	AFDB:P97306	0.345	0.314	9.233E-30	403	0.393	0.355	P97306.pdb.gz	STAC_MOUSE SH3 and cysteine-rich domain-containing protein OS=Mus musculus OX=10090 GN=Stac PE=1 SV=1
4	AFDB:Q8WUK8	0.353	0.322	2.557E-27	402	0.385	0.348	Q8WUK8.pdb.gz	Q8WUK8_HUMAN SH3 and cysteine rich domain OS=Homo sapiens OX=9606 GN=STAC PE=1 SV=1
5	AFDB:Q6ZMT1	0.328	0.291	5.781E-26	411	0.354	0.314	Q6ZMT1.pdb.gz	STAC2_HUMAN SH3 and cysteine-rich domain-containing protein 2 OS=Homo sapiens OX=9606 GN=STAC2 PE=1 SV=1
6	AFDB:A0A0B4LFI1	0.301	0.103	2.103E-17	1089	0.242	0.081	A0A0B4LFI1.pdb.gz	A0A0B4LFI1_DROME Stac-like, isoform U OS=Drosophila melanogaster OX=7227 GN=Stacl PE=4 SV=1
7	AFDB:A0A0B4KG20	0.309	0.100	5.939E-16	1166	0.258	0.081	A0A0B4KG20.pdb.gz	A0A0B4KG20_DROME Stac-like, isoform H OS=Drosophila melanogaster OX=7227 GN=Stacl PE=4 SV=1
8	AFDB:A0A0B4LGK0	0.311	0.100	1.016E-14	1198	0.253	0.077	A0A0B4LGK0.pdb.gz	A0A0B4LGK0_DROME Stac-like, isoform V OS=Drosophila melanogaster OX=7227 GN=Stacl PE=4 SV=1
9	AFDB:M9ND00	0.158	0.050	3.576E-10	1190	0.104	0.032	M9ND00.pdb.gz	M9ND00_DROME Dynamin associated protein 160, isoform D OS=Drosophila melanogaster OX=7227 GN=Dap160 PE=1 SV=1
10	AFDB:Q8INU2	0.155	0.056	4.994E-10	1014	0.146	0.052	Q8INU2.pdb.gz	Q8INU2_DROME Dynamin associated protein 160, isoform B OS=Drosophila melanogaster OX=7227 GN=Dap160 PE=1 SV=1
11	PDB:2lqnA	0.149	0.178	1.664E-5	303	0.071	0.086	2lqnA.pdb.gz
12	PDB:1griA	0.147	0.248	8.363E-5	211	0.069	0.118	1griA.pdb.gz
13	PDB:2dybA	0.151	0.184	2.409E-4	298	0.052	0.064	2dybA.pdb.gz
14	PDB:2h8hA	0.139	0.114	3.010E-4	445	0.041	0.034	2h8hA.pdb.gz	N-(5-chloro-1,3-benzodioxol-4-yl)-7-[2-(4-methylpiperazin-1-yl)ethoxy]-5- (tetrahydro-2H-pyran-4-yloxy)quinazolin-4-amine, a novel, highly selective, orally available, dual-specific c-Src/Abl kinase inhibitor.
15	PDB:2eyzA	0.151	0.180	3.557E-4	304	0.077	0.092	2eyzA.pdb.gz
16	PDB:1k9aB	0.145	0.120	6.940E-4	441	0.049	0.041	1k9aB.pdb.gz
17	PDB:3qwyA	0.148	0.311	8.201E-4	170	0.036	0.076	3qwyA.pdb.gz
18	PDB:3ehqA	0.146	0.286	1.431E-3	182	0.047	0.093	3ehqA.pdb.gz
19	PDB:4mt6A	0.135	0.126	2.234E-3	389	0.047	0.044	4mt6A.pdb.gz
20	PDB:1k0xA	0.139	0.438	2.792E-3	108	0.052	0.176	1k0xA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8BZ71	0.0	625	360	0.923	0.933	STAC3_MOUSE SH3 and cysteine-rich domain-containing protein 3 OS=Mus musculus OX=10090 GN=Stac3 PE=1 SV=1
2	Q96MF2	0.0	749	364	1.000	1.000	STAC3_HUMAN SH3 and cysteine-rich domain-containing protein 3 OS=Homo sapiens OX=9606 GN=STAC3 PE=1 SV=1
3	Q6DBR6	4.12e-139	400	334	0.585	0.638	STAC3_DANRE SH3 and cysteine-rich domain-containing protein 3 OS=Danio rerio OX=7955 GN=stac3 PE=1 SV=1
4	G3V5D4	7.02e-122	350	168	0.462	1.000	G3V5D4_HUMAN SH3 and cysteine rich domain 3 (Fragment) OS=Homo sapiens OX=9606 GN=STAC3 PE=1 SV=1
5	Q99469	1.07e-71	231	402	0.327	0.296	STAC_HUMAN SH3 and cysteine-rich domain-containing protein OS=Homo sapiens OX=9606 GN=STAC PE=1 SV=1
6	Q8WUK8	2.01e-71	230	402	0.327	0.296	Q8WUK8_HUMAN SH3 and cysteine rich domain OS=Homo sapiens OX=9606 GN=STAC PE=1 SV=1
7	P97306	3.82e-71	229	403	0.338	0.305	STAC_MOUSE SH3 and cysteine-rich domain-containing protein OS=Mus musculus OX=10090 GN=Stac PE=1 SV=1
8	Q6ZMT1	5.42e-63	208	411	0.330	0.292	STAC2_HUMAN SH3 and cysteine-rich domain-containing protein 2 OS=Homo sapiens OX=9606 GN=STAC2 PE=1 SV=1
9	Q8R1B0	2.01e-61	204	408	0.324	0.289	STAC2_MOUSE SH3 and cysteine-rich domain-containing protein 2 OS=Mus musculus OX=10090 GN=Stac2 PE=1 SV=1
10	A8DYE9	4.12e-22	99.8	546	0.129	0.086	A8DYE9_DROME Stac-like, isoform E OS=Drosophila melanogaster OX=7227 GN=Stacl PE=4 SV=2
11	A0A0B4LFI1	1.13e-21	99.0	1089	0.129	0.043	A0A0B4LFI1_DROME Stac-like, isoform U OS=Drosophila melanogaster OX=7227 GN=Stacl PE=4 SV=1
12	A0A0B4LGK0	1.08e-18	90.1	1198	0.129	0.039	A0A0B4LGK0_DROME Stac-like, isoform V OS=Drosophila melanogaster OX=7227 GN=Stacl PE=4 SV=1
13	A0A0B4KER3	1.44e-18	89.7	1156	0.129	0.041	A0A0B4KER3_DROME Stac-like, isoform O OS=Drosophila melanogaster OX=7227 GN=Stacl PE=4 SV=1
14	A0A0B4KG20	1.59e-18	89.7	1166	0.129	0.040	A0A0B4KG20_DROME Stac-like, isoform H OS=Drosophila melanogaster OX=7227 GN=Stacl PE=4 SV=1
15	A0A0B4KEV7	7.42e-18	87.8	1970	0.129	0.024	A0A0B4KEV7_DROME Stac-like, isoform J OS=Drosophila melanogaster OX=7227 GN=Stacl PE=4 SV=1
16	A0A0B4KFR2	8.50e-18	87.4	1951	0.129	0.024	A0A0B4KFR2_DROME Stac-like, isoform I OS=Drosophila melanogaster OX=7227 GN=Stacl PE=4 SV=1
17	A6NMU3	4.18e-10	60.5	173	0.063	0.133	A6NMU3_HUMAN Signal transducing adaptor molecule (Fragment) OS=Homo sapiens OX=9606 GN=STAM PE=1 SV=2
18	O01498	8.95e-10	62.0	457	0.088	0.070	STAM1_CAEEL Signal transducing adapter molecule 1 OS=Caenorhabditis elegans OX=6239 GN=stam-1 PE=1 SV=2
19	O75791	1.43e-09	60.8	330	0.066	0.073	GRAP2_HUMAN GRB2-related adapter protein 2 OS=Homo sapiens OX=9606 GN=GRAP2 PE=1 SV=1
20	P70297	1.43e-09	61.6	548	0.066	0.044	STAM1_MOUSE Signal transducing adapter molecule 1 OS=Mus musculus OX=10090 GN=Stam PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00130 C1_1	5.5e-06	37.5	Phorbol esters/diacylglycerol binding domain (C1 domain)
2	PF03107 C1_2	25	16.6	C1 domain
3	PF00628 PHD	7.1e+02	11.5	PHD-finger
4	PF00018 SH3_1	4.8e-11	53.4	SH3 domain
5	PF07653 SH3_2	4.3e-12	57.0	Variant SH3 domain
6	PF14604 SH3_9	1e-11	55.9	Variant SH3 domain
7	PF16664 STAC2_u1	1.6e-06	39.9	Unstructured on SH3 and cysteine-rich domain-containing protein 2

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000329200

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000355192	0.981	Voltage-dependent L-type calcium channel subunit alpha-1S
2	9606.ENSP00000352608	0.958	Ryanodine receptor 1
3	9606.ENSP00000266376	0.876	Voltage-dependent L-type calcium channel subunit alpha-1C
4	9606.ENSP00000288139	0.800	Voltage-dependent L-type calcium channel subunit alpha-1D
5	9606.ENSP00000356545	0.768	Voltage-dependent R-type calcium channel subunit alpha-1E
6	9606.ENSP00000360423	0.766	Voltage-dependent N-type calcium channel subunit alpha-1B
7	9606.ENSP00000383003	0.764	Peptidyl-prolyl cis-trans isomerase FKBP1A
8	9606.ENSP00000365441	0.762	Voltage-dependent L-type calcium channel subunit alpha-1F
9	9606.ENSP00000334198	0.753	Voltage-dependent T-type calcium channel subunit alpha-1H
10	9606.ENSP00000372169	0.753	Voltage-dependent calcium channel subunit alpha-2/delta-4
11	9606.ENSP00000320025	0.750	Voltage-dependent L-type calcium channel subunit beta-2
12	9606.ENSP00000349320	0.735	Voltage-dependent calcium channel subunit alpha-2/delta-1
13	9606.ENSP00000226021	0.734	Voltage-dependent calcium channel gamma-1 subunit
14	9606.ENSP00000282611	0.728	Cation channel sperm-associated protein 3
15	9606.ENSP00000309052	0.727	Cation channel sperm-associated protein 1
16	9606.ENSP00000438949	0.727	Voltage-dependent L-type calcium channel subunit beta-4
17	9606.ENSP00000252729	0.726	Voltage-dependent calcium channel gamma-6 subunit
18	9606.ENSP00000301050	0.722	Voltage-dependent L-type calcium channel subunit beta-3
19	9606.ENSP00000378199	0.722	Heat shock-related 70 kDa protein 2
20	9606.ENSP00000005284	0.720	Voltage-dependent calcium channel gamma-3 subunit

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0042802	0.994	identical protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.985	cellular process
GO:0050794	0.978	regulation of cellular process
GO:0032412	0.957	regulation of monoatomic ion transmembrane transporter activity
GO:0006936	0.948	muscle contraction
GO:0010959	0.928	regulation of metal ion transport
GO:1901019	0.922	regulation of calcium ion transmembrane transporter activity
GO:0043270	0.884	positive regulation of monoatomic ion transport
GO:0032502	0.858	developmental process
GO:0006941	0.846	striated muscle contraction
GO:0051928	0.845	positive regulation of calcium ion transport
GO:0048856	0.840	anatomical structure development
GO:0007267	0.839	cell-cell signaling
GO:0044093	0.818	positive regulation of molecular function
GO:1904427	0.810	positive regulation of calcium ion transmembrane transport
GO:2001257	0.779	regulation of cation channel activity
GO:0032414	0.771	positive regulation of ion transmembrane transporter activity
GO:0007268	0.724	chemical synaptic transmission
GO:0061061	0.719	muscle structure development
GO:1905475	0.688	regulation of protein localization to membrane
GO:1904375	0.684	regulation of protein localization to cell periphery
GO:0007274	0.658	neuromuscular synaptic transmission
GO:0050881	0.586	musculoskeletal movement
GO:0007517	0.581	muscle organ development
GO:0003009	0.575	skeletal muscle contraction
GO:1904377	0.516	positive regulation of protein localization to cell periphery
GO:0060537	0.483	muscle tissue development
GO:0060538	0.472	skeletal muscle organ development
GO:0050896	0.463	response to stimulus
GO:0007519	0.429	skeletal muscle tissue development
GO:1901021	0.410	positive regulation of calcium ion transmembrane transporter activity
GO:1901385	0.405	regulation of voltage-gated calcium channel activity
GO:2001259	0.377	positive regulation of cation channel activity
GO:1903078	0.317	positive regulation of protein localization to plasma membrane
GO:0042692	0.305	muscle cell differentiation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.999	cytosol
GO:0043231	0.997	intracellular membrane-bounded organelle
GO:0070013	0.997	intracellular organelle lumen
GO:0005634	0.981	nucleus
GO:0016020	0.974	membrane
GO:0031981	0.967	nuclear lumen
GO:0005654	0.964	nucleoplasm
GO:0005886	0.956	plasma membrane
GO:0032991	0.900	protein-containing complex
GO:0034703	0.643	cation channel complex
GO:0034704	0.627	calcium channel complex
GO:0005891	0.620	voltage-gated calcium channel complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]