StarFunc result for job id Q96MF7

User Input

>input (247 residues)
MPGRSSSNSGSTGFISFSGVESALSSLKNFQACINSGMDTASSVALDLVESQTEVSSEYS
MDKAMVEFATLDRQLNHYVKAVQSTINHVKEERPEKIPDLKLLVEKKFLALQSKNSDADF
QNNEKFVQFKQQLKELKKQCGLQADREADGTEGVDEDIIVTQSQTNFTCPITKEEMKKPV
KNKVCGHTYEEDAIVRMIESRQKRKKKAYCPQIGCSHTDIRKSDLIQDEALRRAIENHNK
KRHRHSE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A024R9J6	0.700	0.700	3.893E-37	247	1.000	1.000	A0A024R9J6.pdb.gz
2	AFDB:Q4PIR3	0.409	0.404	7.063E-10	250	0.186	0.184	Q4PIR3.pdb.gz	NSE2_SCHPO E3 SUMO-protein ligase nse2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=nse2 PE=1 SV=3
3	AFDB:Q8GYH7	0.405	0.402	4.988E-9	249	0.227	0.225	Q8GYH7.pdb.gz	NSE2_ARATH E3 SUMO-protein ligase MMS21 OS=Arabidopsis thaliana OX=3702 GN=MMS21 PE=1 SV=1
4	AFDB:Q9VVH7	0.292	0.309	1.010E-8	233	0.194	0.206	Q9VVH7.pdb.gz	Q9VVH7_DROME E3 SUMO-protein ligase NSE2 OS=Drosophila melanogaster OX=7227 GN=qjt PE=2 SV=2
5	AFDB:Q8VZ40	0.232	0.102	7.277E-4	632	0.182	0.071	Q8VZ40.pdb.gz	PUB14_ARATH U-box domain-containing protein 14 OS=Arabidopsis thaliana OX=3702 GN=PUB14 PE=1 SV=1
6	AFDB:E4NKF8	0.265	0.099	7.683E-4	694	0.138	0.049	E4NKF8.pdb.gz	PUB1_MEDTR U-box domain-containing protein 1 OS=Medicago truncatula OX=3880 GN=PUB1 PE=1 SV=1
7	AFDB:Q9SNC6	0.245	0.098	7.683E-4	660	0.146	0.055	Q9SNC6.pdb.gz	PUB13_ARATH U-box domain-containing protein 13 OS=Arabidopsis thaliana OX=3702 GN=PUB13 PE=1 SV=1
8	AFDB:Q9LM76	0.264	0.086	2.828E-3	801	0.101	0.031	Q9LM76.pdb.gz	PUB44_ARATH U-box domain-containing protein 44 OS=Arabidopsis thaliana OX=3702 GN=PUB44 PE=1 SV=1
9	PDB:7qcdC	0.277	0.259	5.334E-3	267	0.146	0.135	7qcdC.pdb.gz	Cryo-EM structure of the Smc5/6 holo-complex.
10	AFDB:Q9VPT5	0.204	0.171	5.728E-3	297	0.134	0.111	Q9VPT5.pdb.gz	PEX12_DROME Peroxisome assembly protein 12 OS=Drosophila melanogaster OX=7227 GN=Pex12 PE=2 SV=1
11	AFDB:Q9SFX2	0.265	0.085	6.741E-3	811	0.093	0.028	Q9SFX2.pdb.gz	PUB43_ARATH U-box domain-containing protein 43 OS=Arabidopsis thaliana OX=3702 GN=PUB43 PE=2 SV=1
12	PDB:3m62A	0.275	0.077	1.141E-2	955	0.142	0.037	3m62A.pdb.gz
13	PDB:4r8pL	0.256	0.249	3.200E-2	254	0.085	0.083	4r8pL.pdb.gz	Crystal structure of the PRC1 ubiquitylation module bound to the nucleosome.
14	PDB:2c2lA	0.241	0.214	4.941E-2	281	0.154	0.135	2c2lA.pdb.gz	Chaperoned Ubiquitylation-Crystal Structures of the Chip U Box E3 Ubiquitin Ligase and a Chip-Ubc13-Uev1A Complex
15	PDB:7jzvA	0.247	0.241	1.722E-1	253	0.073	0.071	7jzvA.pdb.gz	BRCA1/BARD1 site-specific ubiquitylation of nucleosomal H2A is directed by BARD1.
16	PDB:7uhyD	0.156	0.137	4.832E-1	288	0.109	0.094	7uhyD.pdb.gz	Structure of the nutrient-sensing hub GATOR2.
17	PDB:4a0cF	0.166	0.449	5.102E-1	80	0.061	0.188	4a0cF.pdb.gz	The Molecular Basis of Crl4(Ddb2/Csa) Ubiquitin Ligase Architecture, Targeting, and Activation
18	PDB:5gm6a	0.161	0.297	5.102E-1	123	0.065	0.130	5gm6a.pdb.gz	Structure of a yeast activated spliceosome at 3.5 angstrom resolution
19	PDB:3jb9U	0.174	0.105	6.340E-1	430	0.065	0.037	3jb9U.pdb.gz	Structure of a yeast spliceosome at 3.6-angstrom resolution
20	PDB:3c98B	0.230	0.241	7.067E-1	230	0.057	0.061	3c98B.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q96MF7	0.0	513	247	1.000	1.000	NSE2_HUMAN E3 SUMO-protein ligase NSE2 OS=Homo sapiens OX=9606 GN=NSMCE2 PE=1 SV=2
2	E5RHW9	1.62e-142	399	193	0.781	1.000	E5RHW9_HUMAN E3 SUMO-protein ligase NSE2 (Fragment) OS=Homo sapiens OX=9606 GN=NSMCE2 PE=1 SV=1
3	E5RFJ1	1.78e-139	390	187	0.757	1.000	E5RFJ1_HUMAN E3 SUMO-protein ligase NSE2 OS=Homo sapiens OX=9606 GN=NSMCE2 PE=1 SV=1
4	Q8I8I0	1.56e-11	63.9	210	0.146	0.171	Q8I8I0_DROME E3 SUMO-protein ligase NSE2 OS=Drosophila melanogaster OX=7227 GN=qjt PE=3 SV=1
5	Q8I8H8	1.98e-11	63.5	210	0.146	0.171	Q8I8H8_DROME E3 SUMO-protein ligase NSE2 OS=Drosophila melanogaster OX=7227 GN=qjt PE=3 SV=1
6	Q8I8H9	2.14e-11	63.5	210	0.146	0.171	Q8I8H9_DROME E3 SUMO-protein ligase NSE2 OS=Drosophila melanogaster OX=7227 GN=qjt PE=3 SV=1
7	Q008Y9	2.27e-11	63.5	210	0.146	0.171	Q008Y9_DROME E3 SUMO-protein ligase NSE2 (Fragment) OS=Drosophila melanogaster OX=7227 GN=qjt PE=3 SV=1
8	Q8I0B8	3.21e-11	63.2	210	0.146	0.171	Q8I0B8_DROME E3 SUMO-protein ligase NSE2 OS=Drosophila melanogaster OX=7227 GN=qjt PE=3 SV=1
9	Q008Z0	3.28e-11	63.2	210	0.146	0.171	Q008Z0_DROME E3 SUMO-protein ligase NSE2 (Fragment) OS=Drosophila melanogaster OX=7227 GN=qjt PE=3 SV=1
10	Q9VVH7	3.35e-11	63.5	233	0.146	0.155	Q9VVH7_DROME E3 SUMO-protein ligase NSE2 OS=Drosophila melanogaster OX=7227 GN=qjt PE=2 SV=2
11	Q8I8I1	3.38e-11	63.2	210	0.146	0.171	Q8I8I1_DROME E3 SUMO-protein ligase NSE2 OS=Drosophila melanogaster OX=7227 GN=qjt PE=3 SV=1
12	Q8GYH7	2.22e-10	61.2	249	0.206	0.205	NSE2_ARATH E3 SUMO-protein ligase MMS21 OS=Arabidopsis thaliana OX=3702 GN=MMS21 PE=1 SV=1
13	Q4PIR3	1.14e-05	47.8	250	0.105	0.104	NSE2_SCHPO E3 SUMO-protein ligase nse2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=nse2 PE=1 SV=3
14	P38632	0.002	40.8	267	0.077	0.071	NSE2_YEAST E3 SUMO-protein ligase MMS21 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MMS21 PE=1 SV=2
15	A0A0A7EPL0	0.003	40.8	847	0.121	0.035	PIAL1_ARATH E4 SUMO-protein ligase PIAL1 OS=Arabidopsis thaliana OX=3702 GN=PIAL1 PE=1 SV=1
16	O94451	0.009	39.3	727	0.101	0.034	PLI1_SCHPO E3 SUMO-protein ligase pli1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=pli1 PE=1 SV=3
17	Q84TG3	0.013	38.9	411	0.105	0.063	PUB23_ARATH E3 ubiquitin-protein ligase PUB23 OS=Arabidopsis thaliana OX=3702 GN=PUB23 PE=1 SV=1
18	Q6EUK7	0.019	38.5	728	0.093	0.032	PUB04_ORYSJ U-box domain-containing protein 4 OS=Oryza sativa subsp. japonica OX=39947 GN=PUB4 PE=2 SV=1
19	Q9SFX2	0.041	37.4	811	0.089	0.027	PUB43_ARATH U-box domain-containing protein 43 OS=Arabidopsis thaliana OX=3702 GN=PUB43 PE=2 SV=1
20	A1A601	0.045	37.0	310	0.069	0.055	A1A601_DANRE E3 ubiquitin-protein ligase RNF115 OS=Danio rerio OX=7955 GN=zgc:158455 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF04641 Rtf2	6.3	17.7	Rtf2 RING-finger
2	PF04564 U-box	0.49	21.9	U-box domain
3	PF00097 zf-C3HC4	1.4e+02	13.8	Zinc finger, C3HC4 type (RING finger)
4	PF13923 zf-C3HC4_2	9	17.5	Zinc finger, C3HC4 type (RING finger)
5	PF02891 zf-MIZ	3.3	18.9	MIZ/SP-RING zinc finger
6	PF11789 zf-Nse	5.1e-18	76.0	Zinc-finger of the MIZ type in Nse subunit
7	PF13445 zf-RING_UBOX	0.0005	31.4	RING-type zinc-finger

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000287437

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000354957	0.999	Structural maintenance of chromosomes protein 5
2	9606.ENSP00000404092	0.999	Structural maintenance of chromosomes protein 6
3	9606.ENSP00000355077	0.998	Non-structural maintenance of chromosomes element 1 homolog
4	9606.ENSP00000330694	0.997	Non-structural maintenance of chromosomes element 3 homolog
5	9606.ENSP00000348056	0.997	SUMO-conjugating enzyme UBC9
6	9606.ENSP00000435619	0.995	EP300-interacting inhibitor of differentiation 3
7	9606.ENSP00000358019	0.991	Non-structural maintenance of chromosomes element 4 homolog A
8	9606.ENSP00000354720	0.983	Structural maintenance of chromosomes protein 3
9	9606.ENSP00000376077	0.977	Small ubiquitin-related modifier 1
10	9606.ENSP00000297338	0.963	Double-strand-break repair protein rad21 homolog
11	9606.ENSP00000323421	0.963	Structural maintenance of chromosomes protein 1A
12	9606.ENSP00000318635	0.962	Small ubiquitin-related modifier 4
13	9606.ENSP00000218089	0.937	Cohesin subunit SA-2
14	9606.ENSP00000372689	0.921	Cohesin subunit SA-1
15	9606.ENSP00000465676	0.878	E3 SUMO-protein ligase PIAS2
16	9606.ENSP00000246548	0.870	SUMO-activating enzyme subunit 2
17	9606.ENSP00000351284	0.824	DNA repair protein RAD52 homolog
18	9606.ENSP00000343741	0.820	Serine/threonine-protein kinase ATR
19	9606.ENSP00000442336	0.819	DNA topoisomerase 3-alpha
20	9606.ENSP00000270225	0.802	SUMO-activating enzyme subunit 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0019789	0.998	SUMO transferase activity
GO:0061659	0.529	ubiquitin-like protein ligase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0065007	0.997	biological regulation
GO:0050794	0.994	regulation of cellular process
GO:0051276	0.989	chromosome organization
GO:0000725	0.985	recombinational repair
GO:0006302	0.984	double-strand break repair
GO:0000723	0.979	telomere maintenance
GO:0033044	0.974	regulation of chromosome organization
GO:0006312	0.973	mitotic recombination
GO:0051983	0.972	regulation of chromosome segregation
GO:0000724	0.972	double-strand break repair via homologous recombination
GO:0048518	0.966	positive regulation of biological process
GO:0045787	0.963	positive regulation of cell cycle
GO:0033045	0.963	regulation of sister chromatid segregation
GO:0010965	0.960	regulation of mitotic sister chromatid separation
GO:0032446	0.960	protein modification by small protein conjugation
GO:0051783	0.958	regulation of nuclear division
GO:1901987	0.955	regulation of cell cycle phase transition
GO:0090398	0.934	cellular senescence
GO:0090068	0.934	positive regulation of cell cycle process
GO:0010638	0.932	positive regulation of organelle organization
GO:0000722	0.925	telomere maintenance via recombination
GO:2001252	0.920	positive regulation of chromosome organization
GO:0018193	0.906	peptidyl-amino acid modification
GO:0030071	0.905	regulation of mitotic metaphase/anaphase transition
GO:0007088	0.903	regulation of mitotic nuclear division
GO:1901989	0.875	positive regulation of cell cycle phase transition
GO:0016925	0.859	protein sumoylation
GO:0051785	0.855	positive regulation of nuclear division
GO:1905820	0.852	positive regulation of chromosome separation
GO:0045840	0.831	positive regulation of mitotic nuclear division
GO:0045931	0.821	positive regulation of mitotic cell cycle
GO:1901992	0.771	positive regulation of mitotic cell cycle phase transition
GO:0019222	0.371	regulation of metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016604	0.999	nuclear body
GO:0043232	0.969	intracellular non-membrane-bounded organelle
GO:0032991	0.961	protein-containing complex
GO:0005694	0.859	chromosome
GO:1902494	0.775	catalytic complex
GO:0098687	0.501	chromosomal region
GO:1990234	0.475	transferase complex
GO:0005737	0.308	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.-.-.-	1.000	Transferases.

[back to server]