StarFunc result for job id Q96MG7

User Input

>input (304 residues)
MLQKPRNRGRSGGQAERDRDWSHSGNPGASRAGEDARVLRDGFAEEAPSTSRGPGGSQGS
QGPSPQGARRAQAAPAVGPRSQKQLELKVSELVQFLLIKDQKKIPIKRADILKHVIGDYK
DIFPDLFKRAAERLQYVFGYKLVELEPKSNTYILINTLEPVEEDAEMRGDQGTPTTGLLM
IVLGLIFMKGNTIKETEAWDFLRRLGVYPTKKHLIFGDPKKLITEDFVRQRYLEYRRIPH
TDPVDYEFQWGPRTNLETSKMKVLKFVAKVHNQDPKDWPAQYCEALADEENRARPQPSGP
APSS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q96MG7	1.000	1.000	3.469E-51	304	1.000	1.000	Q96MG7.pdb.gz	NSE3_HUMAN Non-structural maintenance of chromosomes element 3 homolog OS=Homo sapiens OX=9606 GN=NSMCE3 PE=1 SV=1
2	AFDB:Q9CPR8	0.764	0.831	1.517E-41	279	0.766	0.835	Q9CPR8.pdb.gz	NSE3_MOUSE Non-structural maintenance of chromosomes element 3 homolog OS=Mus musculus OX=10090 GN=Nsmce3 PE=1 SV=1
3	AFDB:Q9HAY2	0.639	0.633	3.995E-29	307	0.480	0.476	Q9HAY2.pdb.gz	MAGF1_HUMAN Melanoma-associated antigen F1 OS=Homo sapiens OX=9606 GN=MAGEF1 PE=1 SV=2
4	AFDB:Q001T8	0.648	0.797	9.058E-26	246	0.391	0.484	Q001T8.pdb.gz	Q001T8_CHICK MAGE protein OS=Gallus gallus OX=9031 GN=mage PE=4 SV=1
5	AFDB:E9Q1Q4	0.683	0.701	1.522E-25	296	0.375	0.385	E9Q1Q4.pdb.gz	E9Q1Q4_MOUSE Trophinin OS=Mus musculus OX=10090 GN=Tro PE=1 SV=1
6	AFDB:Q5H907	0.669	0.396	2.031E-25	521	0.372	0.217	Q5H907.pdb.gz	Q5H907_HUMAN MAGE family member D2 OS=Homo sapiens OX=9606 GN=MAGED2 PE=1 SV=1
7	AFDB:Q99NC2	0.664	0.257	8.102E-25	804	0.401	0.152	Q99NC2.pdb.gz	Q99NC2_MOUSE MAGE-necdin/trophinin complex (Magphinin) OS=Mus musculus OX=10090 GN=Tro PE=2 SV=1
8	AFDB:A0A024R9Y7	0.668	0.341	1.816E-24	606	0.375	0.188	A0A024R9Y7.pdb.gz
9	AFDB:Q9HCI5	0.655	0.217	3.425E-24	957	0.388	0.123	Q9HCI5.pdb.gz	MAGE1_HUMAN Melanoma-associated antigen E1 OS=Homo sapiens OX=9606 GN=MAGEE1 PE=1 SV=2
10	AFDB:Q9UJ55	0.664	0.168	3.628E-24	1249	0.405	0.098	Q9UJ55.pdb.gz	MAGL2_HUMAN MAGE-like protein 2 OS=Homo sapiens OX=9606 GN=MAGEL2 PE=1 SV=2
11	PDB:7qcdE	0.502	0.577	2.108E-7	261	0.141	0.165	7qcdE.pdb.gz	Cryo-EM structure of the Smc5/6 holo-complex.
12	PDB:7tveF	0.550	0.613	3.975E-7	270	0.128	0.144	7tveF.pdb.gz	Cryo-EM structure of DNA-bound Smc5/6 reveals DNA clamping enabled by multi-subunit conformational changes.
13	PDB:3cuqA	0.227	0.289	1.610E-2	219	0.079	0.110	3cuqA.pdb.gz
14	PDB:7d58O	0.193	0.127	3.408E-2	490	0.095	0.059	7d58O.pdb.gz	Structural insights into transcriptional regulation of human RNA polymerase III.
15	PDB:7a6hO	0.187	0.119	6.066E-2	512	0.082	0.049	7a6hO.pdb.gz	Cryo-EM structures of human RNA polymerase III in its unbound and transcribing states.
16	PDB:5hs7A	0.198	0.458	1.360E-1	102	0.072	0.216	5hs7A.pdb.gz
17	PDB:1u5tA	0.224	0.297	1.617E-1	213	0.043	0.061	1u5tA.pdb.gz
18	PDB:3j6bL	0.101	0.127	1.922E-1	229	0.082	0.109	3j6bL.pdb.gz	Structure of the yeast mitochondrial large ribosomal subunit.
19	PDB:1w7pD	0.199	0.298	2.036E-1	171	0.082	0.146	1w7pD.pdb.gz
20	PDB:3gygA	0.110	0.117	2.036E-1	285	0.079	0.084	3gygA.pdb.gz	Crystal structure of yhjK (haloacid dehalogenase-like hydrolase protein) from Bacillus subtilis

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q96MG7	0.0	625	304	1.000	1.000	NSE3_HUMAN Non-structural maintenance of chromosomes element 3 homolog OS=Homo sapiens OX=9606 GN=NSMCE3 PE=1 SV=1
2	Q9CPR8	1.88e-167	467	279	0.766	0.835	NSE3_MOUSE Non-structural maintenance of chromosomes element 3 homolog OS=Mus musculus OX=10090 GN=Nsmce3 PE=1 SV=1
3	Q9HAY2	8.79e-82	251	307	0.480	0.476	MAGF1_HUMAN Melanoma-associated antigen F1 OS=Homo sapiens OX=9606 GN=MAGEF1 PE=1 SV=2
4	Q001T8	1.55e-76	236	246	0.401	0.496	Q001T8_CHICK MAGE protein OS=Gallus gallus OX=9031 GN=mage PE=4 SV=1
5	Q5H907	9.95e-69	224	521	0.372	0.217	Q5H907_HUMAN MAGE family member D2 OS=Homo sapiens OX=9606 GN=MAGED2 PE=1 SV=1
6	Q5H909	4.11e-68	224	588	0.342	0.177	Q5H909_HUMAN MAGE family member D2 OS=Homo sapiens OX=9606 GN=MAGED2 PE=1 SV=2
7	Q9UNF1	4.92e-68	224	606	0.342	0.172	MAGD2_HUMAN Melanoma-associated antigen D2 OS=Homo sapiens OX=9606 GN=MAGED2 PE=1 SV=2
8	E9Q1Q4	8.07e-68	215	296	0.345	0.355	E9Q1Q4_MOUSE Trophinin OS=Mus musculus OX=10090 GN=Tro PE=1 SV=1
9	E9Q098	8.60e-68	228	838	0.345	0.125	E9Q098_MOUSE Trophinin OS=Mus musculus OX=10090 GN=Tro PE=1 SV=1
10	Q99NC2	1.01e-67	227	804	0.345	0.131	Q99NC2_MOUSE MAGE-necdin/trophinin complex (Magphinin) OS=Mus musculus OX=10090 GN=Tro PE=2 SV=1
11	Q99PH7	1.03e-67	228	831	0.345	0.126	Q99PH7_MOUSE Magphinin-beta 2 OS=Mus musculus OX=10090 GN=Tro PE=2 SV=1
12	Q99PM5	1.33e-67	228	906	0.345	0.116	Q99PM5_MOUSE Magphinin-alpha OS=Mus musculus OX=10090 GN=Tro PE=2 SV=1
13	E9Q886	3.26e-67	228	972	0.345	0.108	E9Q886_MOUSE Trophinin OS=Mus musculus OX=10090 GN=Tro PE=1 SV=1
14	Q99PW2	4.53e-67	227	965	0.345	0.109	Q99PW2_MOUSE Trophinin-2 OS=Mus musculus OX=10090 GN=Tro PE=2 SV=1
15	Q9HCI5	1.05e-66	226	957	0.336	0.107	MAGE1_HUMAN Melanoma-associated antigen E1 OS=Homo sapiens OX=9606 GN=MAGEE1 PE=1 SV=2
16	O15481	3.46e-65	210	346	0.329	0.289	MAGB4_HUMAN Melanoma-associated antigen B4 OS=Homo sapiens OX=9606 GN=MAGEB4 PE=1 SV=1
17	Q8BQR7	9.23e-65	208	327	0.326	0.303	MAGBI_MOUSE Melanoma-associated antigen B18 OS=Mus musculus OX=10090 GN=Mageb18 PE=1 SV=1
18	Q80TJ5	6.35e-64	220	1736	0.345	0.060	Q80TJ5_MOUSE MKIAA1114 protein (Fragment) OS=Mus musculus OX=10090 GN=Tro PE=2 SV=1
19	Q6DIC6	1.95e-62	216	2087	0.345	0.050	Q6DIC6_MOUSE Tro protein OS=Mus musculus OX=10090 GN=Tro PE=1 SV=1
20	Q99PB3	2.96e-62	215	1987	0.345	0.053	Q99PB3_MOUSE Mage-d3 OS=Mus musculus OX=10090 GN=Tro PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF11297 DUF3098	1.5e+02	13.4	Protein of unknown function (DUF3098)
2	PF01454 MAGE	2.2e-26	104.4	MAGE homology domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000330694

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000354957	0.999	Structural maintenance of chromosomes protein 5
2	9606.ENSP00000355077	0.999	Non-structural maintenance of chromosomes element 1 homolog
3	9606.ENSP00000404092	0.999	Structural maintenance of chromosomes protein 6
4	9606.ENSP00000358019	0.998	Non-structural maintenance of chromosomes element 4 homolog A
5	9606.ENSP00000287437	0.997	E3 SUMO-protein ligase NSE2
6	9606.ENSP00000435619	0.995	EP300-interacting inhibitor of differentiation 3
7	9606.ENSP00000345571	0.983	Transcription factor E2F1
8	9606.ENSP00000297338	0.971	Double-strand-break repair protein rad21 homolog
9	9606.ENSP00000172229	0.959	Tumor necrosis factor receptor superfamily member 16
10	9606.ENSP00000354720	0.951	Structural maintenance of chromosomes protein 3
11	9606.ENSP00000323421	0.924	Structural maintenance of chromosomes protein 1A
12	9606.ENSP00000348056	0.923	SUMO-conjugating enzyme UBC9
13	9606.ENSP00000376077	0.918	Small ubiquitin-related modifier 1
14	9606.ENSP00000218089	0.910	Cohesin subunit SA-2
15	9606.ENSP00000358525	0.909	Beta-nerve growth factor
16	9606.ENSP00000372689	0.909	Cohesin subunit SA-1
17	9606.ENSP00000318635	0.906	Small ubiquitin-related modifier 4
18	9606.ENSP00000256637	0.904	Sortilin
19	9606.ENSP00000355014	0.829	E3 ubiquitin-protein ligase Praja-1
20	9606.ENSP00000359310	0.779	Putative chondrosarcoma-associated gene 1 protein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0046983	0.595	protein dimerization activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.999	regulation of biological process
GO:0050794	0.984	regulation of cellular process
GO:0060255	0.970	regulation of macromolecule metabolic process
GO:0009987	0.968	cellular process
GO:0071704	0.961	organic substance metabolic process
GO:0050896	0.947	response to stimulus
GO:0051171	0.924	regulation of nitrogen compound metabolic process
GO:0080090	0.919	regulation of primary metabolic process
GO:0043170	0.907	macromolecule metabolic process
GO:0048518	0.899	positive regulation of biological process
GO:0044238	0.882	primary metabolic process
GO:0006807	0.803	nitrogen compound metabolic process
GO:0044237	0.740	cellular metabolic process
GO:0051716	0.732	cellular response to stimulus
GO:0031323	0.623	regulation of cellular metabolic process
GO:0019219	0.514	regulation of nucleobase-containing compound metabolic process
GO:1901360	0.498	organic cyclic compound metabolic process
GO:0048519	0.494	negative regulation of biological process
GO:0010468	0.489	regulation of gene expression
GO:0048522	0.447	positive regulation of cellular process
GO:0033554	0.445	cellular response to stress
GO:0051252	0.436	regulation of RNA metabolic process
GO:0009893	0.434	positive regulation of metabolic process
GO:0046483	0.430	heterocycle metabolic process
GO:0006725	0.430	cellular aromatic compound metabolic process
GO:0006974	0.412	cellular response to DNA damage stimulus
GO:0090304	0.412	nucleic acid metabolic process
GO:0048523	0.404	negative regulation of cellular process
GO:0010604	0.382	positive regulation of macromolecule metabolic process
GO:0051173	0.379	positive regulation of nitrogen compound metabolic process
GO:0010556	0.338	regulation of macromolecule biosynthetic process
GO:0031326	0.336	regulation of cellular biosynthetic process
GO:0006259	0.336	DNA metabolic process
GO:2001141	0.329	regulation of RNA biosynthetic process
GO:0006355	0.322	regulation of DNA-templated transcription
GO:0051246	0.315	regulation of protein metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.999	nucleoplasm
GO:0032991	0.998	protein-containing complex
GO:0043232	0.991	intracellular non-membrane-bounded organelle
GO:0000793	0.967	condensed chromosome
GO:1990234	0.966	transferase complex
GO:0106068	0.914	SUMO ligase complex
GO:0030915	0.867	Smc5-Smc6 complex
GO:0005737	0.809	cytoplasm
GO:0005829	0.371	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]