StarFunc result for job id Q96MI9

User Input

>input (1112 residues)
MAEQEASGLQVLLHTLQSSSDKESILTILKVLGDLLSVGTDRRIHYMISKGGSEALLQTL
VDTARTAPPDYDILLPLFRLLAKVGLRDKKIGRKALELEALDVTLILARKNLSHGQNLLH
CLWALRVFASSVSMGAMLGINGAMELLFKVITPYTRKRTQAIRAATEVLAALLKSKSNGR
RAVNRGYVTSLLGLHQDWHSHDTANAYVQIRRGLLLCLRHIAALRSGREAFLAAQGMEIL
FSTTQNCLDDKSMEPVISVVLQILRQCYPTSPLPLVTASSAYAFPVPGCITTEPPHDLPE
EDFEDDGDDEVDKDSDTEDGKVEDDDLETDVNKLSSKPGLDRPEEELMQYEVMCLELSYS
FEELQSKLGDDLNSEKTQYANHHHIPAAASSKQHCYSKDQSSCGQEREYAVQTSLLCRVK
TGRSTVHLGSKKNPGVNLYQNVQSNSLRRDSSESEIPDIQASPKADAWDVDAIFCPRMSA
SFSNSTRTREVVKVIDKLLQTHLKRVPFHDPYLYMAKARRTSSVVDFKMMAFPDVWGHCP
PPTTQPMLERKCGVQRIRIFEDIRRLIQPSDVINKVVFSLDEPWPLQDNASNCLRFFSKF
ESGNLRKAIQVREFEYDLLVNADVNSTQHQQWFYFKVSGMQAAIPYHFNIINCEKPNSQF
NYGMQPTLYSVKEALLGKPTWIRTGHEICYYKNHYRQSTAVAGGASGKCYYTLTFAVTFP
HSEDVCYLAYHYPYTYTALMTHLDILEKSVNLKEVYFRQDVLCQTLGGNPCPLVTITAMP
ESNSDEHLEQFRHRPYQVITARVHPGESNASWVMKGTLEFLVSSDPVARLLRENFIFKII
PMLNPDGVINGNHRCSLSGEDLNRQWLSPSAHLQPTIYHAKGLLYHLSSIGRSPVVFCDF
HGHSQKKNVFLYGCSIKETLWQAACTVGTSTILEEVNYRTLPKILDKLAPAFTMSSCSFL
VEKSRASTARVVVWREMGVSRSYTMESSYCGCNQGPYQCTQRLLERTKNERAHPVDGLQG
LQFGTRELEEMGAMFCLGLLILELKSASCSHQLLAQAATLLSAEEDALDQHLQRLKSSNF
LPKHIWFAYHFFAITNFFKMNLLLHVSPVCDT

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q09M05	0.830	0.823	0.000	1122	0.746	0.739	Q09M05.pdb.gz	CBPC4_MOUSE Cytosolic carboxypeptidase 4 OS=Mus musculus OX=10090 GN=Agbl1 PE=1 SV=3
2	AFDB:J3KNS1	0.770	0.673	2.015E-92	1278	0.453	0.394	J3KNS1.pdb.gz	J3KNS1_HUMAN tubulin-glutamate carboxypeptidase OS=Homo sapiens OX=9606 GN=AGTPBP1 PE=1 SV=1
3	AFDB:Q4U2V3	0.753	0.727	2.499E-91	1153	0.436	0.421	Q4U2V3.pdb.gz	CBPC1_DANRE Cytosolic carboxypeptidase 1 OS=Danio rerio OX=7955 GN=agtpbp1 PE=2 SV=1
4	AFDB:A0A024R288	0.700	0.658	1.913E-87	1186	0.441	0.413	A0A024R288.pdb.gz
5	AFDB:O76373	0.505	0.549	3.303E-51	1015	0.225	0.246	O76373.pdb.gz	CBPC1_CAEEL Cytosolic carboxypeptidase 1 OS=Caenorhabditis elegans OX=6239 GN=ccpp-1 PE=1 SV=2
6	AFDB:Q389Q3	0.538	0.398	1.847E-41	1570	0.237	0.168	Q389Q3.pdb.gz	Q389Q3_TRYB2 Zinc carboxypeptidase, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.406.0130 PE=3 SV=1
7	AFDB:Q5U5Z8	0.387	0.474	3.225E-37	902	0.197	0.243	Q5U5Z8.pdb.gz	CBPC2_HUMAN Cytosolic carboxypeptidase 2 OS=Homo sapiens OX=9606 GN=AGBL2 PE=1 SV=2
8	AFDB:Q8CDK2	0.386	0.494	2.706E-36	862	0.191	0.246	Q8CDK2.pdb.gz	CBPC2_MOUSE Cytosolic carboxypeptidase 2 OS=Mus musculus OX=10090 GN=Agbl2 PE=1 SV=1
9	AFDB:Q8NEM8	0.382	0.422	3.219E-36	1001	0.191	0.212	Q8NEM8.pdb.gz	CBPC3_HUMAN Cytosolic carboxypeptidase 3 OS=Homo sapiens OX=9606 GN=AGBL3 PE=2 SV=2
10	AFDB:Q583K9	0.323	0.457	1.166E-26	773	0.139	0.201	Q583K9.pdb.gz	Q583K9_TRYB2 Cytosolic carboxypeptidase-like protein 5 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb04.29M18.130 PE=3 SV=1
11	PDB:1ayeA	0.184	0.459	9.206E-7	401	0.043	0.120	1ayeA.pdb.gz	The three-dimensional structure of human procarboxypeptidase A2. Deciphering the basis of the inhibition, activation and intrinsic activity of the zymogen.
12	PDB:1kwmA	0.192	0.462	1.484E-6	402	0.059	0.164	1kwmA.pdb.gz	Human procarboxypeptidase B: three-dimensional structure and implications for thrombin-activatable fibrinolysis inhibitor (TAFI).
13	PDB:4p10A	0.187	0.469	2.610E-6	402	0.035	0.097	4p10A.pdb.gz	Design and synthesis of conformationally restricted inhibitors of active thrombin activatable fibrinolysis inhibitor (TAFIa).
14	PDB:5mrvA	0.182	0.568	2.846E-6	307	0.054	0.195	5mrvA.pdb.gz	Crystal structure and mechanism of human carboxypeptidase O: Insights into its specific activity for acidic residues.
15	PDB:2z6gA	0.158	0.290	4.792E-6	550	0.040	0.080	2z6gA.pdb.gz
16	PDB:1uwyA	0.175	0.441	8.426E-6	393	0.034	0.097	1uwyA.pdb.gz	Crystal Structure of Human Carboxypeptidase M, a Membrane-Bound Enzyme that Regulates Peptide Hormone Activity
17	PDB:1h8lA	0.169	0.453	2.287E-5	380	0.031	0.089	1h8lA.pdb.gz	The crystal structure of the inhibitor-complexed carboxypeptidase D domain II and the modeling of regulatory carboxypeptidases.
18	PDB:2nsmA	0.164	0.423	3.530E-5	390	0.031	0.087	2nsmA.pdb.gz
19	PDB:4r0zA	0.171	0.306	9.582E-5	557	0.040	0.081	4r0zA.pdb.gz
20	PDB:7rroH7	0.175	0.310	2.283E-4	580	0.031	0.059	7rroH7.pdb.gz	De novo identification of mammalian ciliary motility proteins using cryo-EM.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	J3KNS1	0.0	735	1278	0.302	0.263	J3KNS1_HUMAN tubulin-glutamate carboxypeptidase OS=Homo sapiens OX=9606 GN=AGTPBP1 PE=1 SV=1
2	Q09M05	0.0	1676	1122	0.741	0.734	CBPC4_MOUSE Cytosolic carboxypeptidase 4 OS=Mus musculus OX=10090 GN=Agbl1 PE=1 SV=3
3	Q4U2V3	0.0	966	1153	0.447	0.431	CBPC1_DANRE Cytosolic carboxypeptidase 1 OS=Danio rerio OX=7955 GN=agtpbp1 PE=2 SV=1
4	Q641K1	0.0	736	1218	0.303	0.277	CBPC1_MOUSE Cytosolic carboxypeptidase 1 OS=Mus musculus OX=10090 GN=Agtpbp1 PE=1 SV=2
5	Q9UPW5	0.0	736	1226	0.302	0.274	CBPC1_HUMAN Cytosolic carboxypeptidase 1 OS=Homo sapiens OX=9606 GN=AGTPBP1 PE=1 SV=3
6	O76373	5.66e-102	347	1015	0.164	0.179	CBPC1_CAEEL Cytosolic carboxypeptidase 1 OS=Caenorhabditis elegans OX=6239 GN=ccpp-1 PE=1 SV=2
7	Q8NEM8	2.93e-101	345	1001	0.164	0.182	CBPC3_HUMAN Cytosolic carboxypeptidase 3 OS=Homo sapiens OX=9606 GN=AGBL3 PE=2 SV=2
8	Q8CDP0	1.66e-100	343	1006	0.165	0.183	CBPC3_MOUSE Cytosolic carboxypeptidase 3 OS=Mus musculus OX=10090 GN=Agbl3 PE=1 SV=1
9	Q8CDK2	2.92e-92	317	862	0.162	0.209	CBPC2_MOUSE Cytosolic carboxypeptidase 2 OS=Mus musculus OX=10090 GN=Agbl2 PE=1 SV=1
10	Q5U5Z8	4.62e-92	317	902	0.157	0.194	CBPC2_HUMAN Cytosolic carboxypeptidase 2 OS=Homo sapiens OX=9606 GN=AGBL2 PE=1 SV=2
11	Q9VY99	2.96e-85	303	1201	0.153	0.142	NNAD_DROME Cytosolic carboxypeptidase Nna1 OS=Drosophila melanogaster OX=7227 GN=Nna1 PE=2 SV=2
12	Q389Q3	2.41e-84	303	1570	0.183	0.130	Q389Q3_TRYB2 Zinc carboxypeptidase, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.406.0130 PE=3 SV=1
13	Q5VU57	1.60e-58	212	503	0.131	0.290	CBPC6_HUMAN Cytosolic carboxypeptidase 6 OS=Homo sapiens OX=9606 GN=AGBL4 PE=2 SV=3
14	Q09LZ8	1.67e-58	213	540	0.132	0.272	CBPC6_MOUSE Cytosolic carboxypeptidase 6 OS=Mus musculus OX=10090 GN=Agbl4 PE=1 SV=1
15	Q09296	5.37e-57	206	459	0.146	0.353	CBPC6_CAEEL Cytosolic carboxypeptidase 6 OS=Caenorhabditis elegans OX=6239 GN=ccpp-6 PE=1 SV=2
16	Q583K9	1.93e-37	154	773	0.130	0.188	Q583K9_TRYB2 Cytosolic carboxypeptidase-like protein 5 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb04.29M18.130 PE=3 SV=1
17	Q09M02	6.14e-32	137	886	0.092	0.115	CBPC5_MOUSE Cytosolic carboxypeptidase-like protein 5 OS=Mus musculus OX=10090 GN=Agbl5 PE=1 SV=2
18	Q8NDL9	1.34e-31	135	886	0.092	0.115	CBPC5_HUMAN Cytosolic carboxypeptidase-like protein 5 OS=Homo sapiens OX=9606 GN=AGBL5 PE=1 SV=1
19	Q68EI3	1.71e-30	132	885	0.085	0.107	CBPC5_DANRE Cytosolic carboxypeptidase-like protein 5 OS=Danio rerio OX=7955 GN=agbl5 PE=2 SV=1
20	Q383Q1	5.90e-27	121	1192	0.103	0.096	Q383Q1_TRYB2 Zinc carboxypeptidase, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.2050 PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF04952 AstE_AspA	1.5e+02	13.0	Succinylglutamate desuccinylase / Aspartoacylase family
2	PF18027 Pepdidase_M14_N	2.3e-09	48.7	Cytosolic carboxypeptidase N-terminal domain
3	PF00246 Peptidase_M14	1.2e-07	43.5	Zinc carboxypeptidase
4	PF06449 YMF19_C	2.5e+02	12.9	ATP synthase YMF19, C-terminal

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000413001

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000300591	0.762	Lipoxygenase homology domain-containing protein 1
2	9606.ENSP00000239587	0.738	Probable tubulin polyglutamylase TTLL2
3	9606.ENSP00000245907	0.731	Complement C3
4	9606.ENSP00000369399	0.706	Sodium bicarbonate transporter-like protein 11
5	9606.ENSP00000381382	0.651	Transcription factor 4
6	9606.ENSP00000352603	0.613	AP-4 complex subunit mu-1
7	9606.ENSP00000380901	0.613	Collagen alpha-2(VIII) chain
8	9606.ENSP00000417185	0.604	Von Willebrand factor A domain-containing protein 1
9	9606.ENSP00000360195	0.531	KN motif and ankyrin repeat domain-containing protein 4
10	9606.ENSP00000297770	0.515	Carboxypeptidase A6

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0015631	1.000	tubulin binding
GO:0004181	1.000	metallocarboxypeptidase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0008152	0.964	metabolic process
GO:0071704	0.952	organic substance metabolic process
GO:0006807	0.936	nitrogen compound metabolic process
GO:0044238	0.914	primary metabolic process
GO:0018200	0.899	peptidyl-glutamic acid modification
GO:0043687	0.887	post-translational protein modification
GO:0009987	0.455	cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0005829	0.991	cytosol
GO:0043229	0.945	intracellular organelle
GO:0043227	0.891	membrane-bounded organelle
GO:0043231	0.871	intracellular membrane-bounded organelle
GO:0005634	0.334	nucleus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.4.17.-	1.000	Metallocarboxypeptidases.

[back to server]