StarFunc result for job id Q96MK3

User Input

>input (541 residues)
MPGLRRDRLLTLLLLGALLSADLYFHLWPQVQRQLRPRERPRGCPCTGRASSLARDSAAA
ASDPGTIVHNFSRTEPRTEPAGGSHSGSSSKLQALFAHPLYNVPEEPPLLGAEDSLLASQ
EALRYYRRKVARWNRRHKMYREQMNLTSLDPPLQLRLEASWVQFHLGINRHGLYSRSSPV
VSKLLQDMRHFPTISADYSQDEKALLGACDCTQIVKPSGVHLKLVLRFSDFGKAMFKPMR
QQRDEETPVDFFYFIDFQRHNAEIAAFHLDRILDFRRVPPTVGRIVNVTKEILEVTKNEI
LQSVFFVSPASNVCFFAKCPYMCKTEYAVCGNPHLLEGSLSAFLPSLNLAPRLSVPNPWI
RSYTLAGKEEWEVNPLYCDTVKQIYPYNNSQRLLNVIDMAIFDFLIGNMDRHHYEMFTKF
GDDGFLIHLDNARGFGRHSHDEISILSPLSQCCMIKKKTLLHLQLLAQADYRLSDVMRES
LLEDQLSPVLTEPHLLALDRRLQTILRTVEGCIVAHGQQSVIVDGPVEQLAPDSGQANLT
S

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q96MK3	1.000	1.000	1.345E-100	541	1.000	1.000	Q96MK3.pdb.gz	FA20A_HUMAN Pseudokinase FAM20A OS=Homo sapiens OX=9606 GN=FAM20A PE=1 SV=4
2	AFDB:Q8CID3	0.877	0.877	3.937E-89	541	0.858	0.858	Q8CID3.pdb.gz	FA20A_MOUSE Pseudokinase FAM20A OS=Mus musculus OX=10090 GN=Fam20a PE=1 SV=1
3	PDB:5yh3A	0.801	0.988	2.654E-75	438	0.808	0.998	5yh3A.pdb.gz	Structure and evolution of the Fam20 kinases
4	AFDB:Q8IXL6	0.736	0.684	1.221E-54	584	0.451	0.418	Q8IXL6.pdb.gz	FA20C_HUMAN Extracellular serine/threonine protein kinase FAM20C OS=Homo sapiens OX=9606 GN=FAM20C PE=1 SV=2
5	AFDB:B1WBN7	0.733	0.686	1.649E-53	579	0.436	0.408	B1WBN7.pdb.gz	B1WBN7_RAT FAM20C OS=Rattus norvegicus OX=10116 GN=Fam20c PE=2 SV=1
6	AFDB:Q1MTC0	0.694	0.739	7.037E-51	507	0.418	0.446	Q1MTC0.pdb.gz	Q1MTC0_DANRE Extracellular serine/threonine protein kinase FAM20C OS=Danio rerio OX=7955 GN=fam20cl PE=1 SV=1
7	AFDB:A4VCL2	0.628	0.351	3.968E-40	980	0.349	0.193	A4VCL2.pdb.gz	FA20C_DROME Extracellular serine/threonine protein CG31145 OS=Drosophila melanogaster OX=7227 GN=CG31145 PE=2 SV=2
8	AFDB:Q5RH51	0.613	0.804	6.978E-36	409	0.270	0.357	Q5RH51.pdb.gz	XYLK_DANRE Glycosaminoglycan xylosylkinase OS=Danio rerio OX=7955 GN=fam20b PE=2 SV=1
9	AFDB:Q9XTW2	0.655	0.689	1.012E-35	512	0.292	0.309	Q9XTW2.pdb.gz	FA20C_CAEEL Extracellular serine/threonine protein kinase CeFam20 OS=Caenorhabditis elegans OX=6239 GN=famk-1 PE=1 SV=1
10	AFDB:A0A024R918	0.617	0.810	1.548E-35	409	0.266	0.352	A0A024R918.pdb.gz
11	AFDB:Q95T10	0.576	0.734	1.569E-27	421	0.226	0.290	Q95T10.pdb.gz	XYLK_DROME Glycosaminoglycan xylosylkinase homolog OS=Drosophila melanogaster OX=7227 GN=CG3631 PE=2 SV=1
12	PDB:8a5xA	0.268	0.306	1.234E-4	466	0.074	0.086	8a5xA.pdb.gz	Structure-based design and modular synthesis of novel PI4K class II inhibitors bearing a 4-aminoquinazoline scaffold.
13	PDB:3akkA	0.225	0.361	1.149E-3	296	0.079	0.145	3akkA.pdb.gz	Helicobacter pylori proinflammatory protein up-regulates NF-kappaB as a cell-translocating Ser/Thr kinase
14	PDB:4wtvB	0.245	0.301	1.580E-3	426	0.074	0.094	4wtvB.pdb.gz	The high-resolution crystal structure of phosphatidylinositol 4-kinase II beta and the crystal structure of phosphatidylinositol 4-kinase II alpha containing a nucleoside analogue provide a structural basis for isoform-specific inhibitor design.
15	PDB:5eutA	0.244	0.269	4.111E-3	485	0.074	0.082	5eutA.pdb.gz
16	PDB:7ktsA	0.142	0.044	9.121E-3	3042	0.081	0.014	7ktsA.pdb.gz
17	PDB:7sicA	0.203	0.054	5.855E-2	2773	0.098	0.019	7sicA.pdb.gz	Structure of the human ATM kinase and mechanism of Nbs1 binding.
18	PDB:8escZ	0.184	0.042	6.511E-2	3543	0.067	0.010	8escZ.pdb.gz	Structure and flexibility of the yeast NuA4 histone acetyltransferase complex.
19	PDB:4ajwB	0.211	0.157	8.955E-2	792	0.057	0.039	4ajwB.pdb.gz	Discovery and Optimization of New Benzimidazole- and Benzoxazole-Pyrimidone Selective Pi3Kbeta Inhibitors for the Treatment of Phosphatase and Tensin Homologue (Pten)-Deficient Cancers.
20	PDB:4ajwA	0.211	0.162	1.606E-1	765	0.057	0.041	4ajwA.pdb.gz	Discovery and Optimization of New Benzimidazole- and Benzoxazole-Pyrimidone Selective Pi3Kbeta Inhibitors for the Treatment of Phosphatase and Tensin Homologue (Pten)-Deficient Cancers.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8CID3	0.0	900	541	0.826	0.826	FA20A_MOUSE Pseudokinase FAM20A OS=Mus musculus OX=10090 GN=Fam20a PE=1 SV=1
2	Q96MK3	0.0	1120	541	1.000	1.000	FA20A_HUMAN Pseudokinase FAM20A OS=Homo sapiens OX=9606 GN=FAM20A PE=1 SV=4
3	Q8IXL6	3.36e-151	447	584	0.414	0.384	FA20C_HUMAN Extracellular serine/threonine protein kinase FAM20C OS=Homo sapiens OX=9606 GN=FAM20C PE=1 SV=2
4	Q5MJS3	3.56e-149	442	579	0.399	0.373	FA20C_MOUSE Extracellular serine/threonine protein kinase FAM20C OS=Mus musculus OX=10090 GN=Fam20c PE=1 SV=1
5	B1WBN7	3.28e-148	439	579	0.409	0.382	B1WBN7_RAT FAM20C OS=Rattus norvegicus OX=10116 GN=Fam20c PE=2 SV=1
6	A0A8I5ZV45	4.54e-147	439	650	0.409	0.340	A0A8I5ZV45_RAT FAM20C, golgi associated secretory pathway kinase OS=Rattus norvegicus OX=10116 GN=Fam20c PE=3 SV=1
7	Q1MTC0	1.12e-139	415	507	0.405	0.432	Q1MTC0_DANRE Extracellular serine/threonine protein kinase FAM20C OS=Danio rerio OX=7955 GN=fam20cl PE=1 SV=1
8	B0V1R7	1.47e-139	414	502	0.405	0.436	B0V1R7_DANRE Extracellular serine/threonine protein kinase FAM20C OS=Danio rerio OX=7955 GN=fam20cl PE=1 SV=1
9	A4VCL2	9.35e-106	328	528	0.298	0.305	FA20C_DROME Extracellular serine/threonine protein CG31145 OS=Drosophila melanogaster OX=7227 GN=CG31145 PE=2 SV=2
10	Q9XTW2	2.17e-79	259	512	0.264	0.279	FA20C_CAEEL Extracellular serine/threonine protein kinase CeFam20 OS=Caenorhabditis elegans OX=6239 GN=famk-1 PE=1 SV=1
11	Q5RH51	8.84e-75	244	409	0.248	0.328	XYLK_DANRE Glycosaminoglycan xylosylkinase OS=Danio rerio OX=7955 GN=fam20b PE=2 SV=1
12	O75063	1.54e-73	241	409	0.259	0.342	XYLK_HUMAN Glycosaminoglycan xylosylkinase OS=Homo sapiens OX=9606 GN=FAM20B PE=1 SV=1
13	Q8VCS3	6.57e-73	239	409	0.257	0.340	XYLK_MOUSE Glycosaminoglycan xylosylkinase OS=Mus musculus OX=10090 GN=Fam20b PE=1 SV=1
14	Q95T10	1.10e-49	178	421	0.201	0.259	XYLK_DROME Glycosaminoglycan xylosylkinase homolog OS=Drosophila melanogaster OX=7227 GN=CG3631 PE=2 SV=1
15	Q86VR8	0.007	41.6	437	0.104	0.128	FJX1_HUMAN Four-jointed box protein 1 OS=Homo sapiens OX=9606 GN=FJX1 PE=2 SV=1
16	Q8BQB4	0.049	38.9	450	0.124	0.149	FJX1_MOUSE Four-jointed box protein 1 OS=Mus musculus OX=10090 GN=Fjx1 PE=1 SV=1
17	Q56YJ8	2.3	33.5	414	0.028	0.036	FAMA_ARATH Transcription factor FAMA OS=Arabidopsis thaliana OX=3702 GN=FAMA PE=1 SV=1
18	Q54W90	8.1	32.0	894	0.028	0.017	SEY1_DICDI Protein SEY1 homolog OS=Dictyostelium discoideum OX=44689 GN=DDB_0206311 PE=3 SV=1
19	Q9US05	9.9	31.2	452	0.033	0.040	BFR2_SCHPO Protein bfr2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=bfr2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF15051 FAM198	8.1	16.8	FAM198 protein
2	PF06702 Fam20C	1e-95	331.0	Golgi casein kinase, C-terminal, Fam20
3	PF00454 PI3_PI4_kinase	3.1e+02	12.6	Phosphatidylinositol 3- and 4-kinase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000468308

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000322323	0.972	Extracellular serine/threonine protein kinase FAM20C
2	9606.ENSP00000400223	0.794	Four-jointed box protein 1
3	9606.ENSP00000379383	0.750	Enamelin
4	9606.ENSP00000481109	0.698	Catalytically inactive protein kinase that acts as a scaffold protein. Functions as an effector of the small GTPase RND2, which stimulates RhoA activity and inhibits NGF-induced neurite outgrowth (By similarity). Promotes Src family kinase (SFK) signaling by regulating the subcellular localization of CSK, a negative regulator of these kinases, leading to the regulation of cell morphology and motility by a CSK-dependent mechanism (By similarity). Acts as a critical coactivator of Notch signaling (By similarity)
5	9606.ENSP00000407301	0.697	Protein FAM198A
6	9606.ENSP00000373565	0.696	Protein FAM83H
7	9606.ENSP00000452796	0.696	Pseudopodium-enriched atypical kinase 1
8	9606.ENSP00000377396	0.679	Protein FAM198B
9	9606.ENSP00000379619	0.679	WD repeat-containing protein 72
10	9606.ENSP00000313809	0.674	Ameloblastin
11	9606.ENSP00000406925	0.664	Odontogenesis associated phosphoprotein
12	9606.ENSP00000352925	0.661	Transformation/transcription domain-associated protein
13	9606.ENSP00000283148	0.659	UDP-glucuronic acid decarboxylase 1
14	9606.ENSP00000261381	0.654	Xylosyltransferase 1
15	9606.ENSP00000341013	0.646	Amelotin
16	9606.ENSP00000381086	0.642	Deleted in autism-related protein 1
17	9606.ENSP00000017003	0.619	Xylosyltransferase 2
18	9606.ENSP00000359333	0.618	Protein FAM69A
19	9606.ENSP00000366275	0.596	Metal transporter CNNM4
20	9606.ENSP00000370088	0.584	Amelogenin, X isoform

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0043539	1.000	protein serine/threonine kinase activator activity
GO:0003824	0.995	catalytic activity
GO:0016773	0.990	phosphotransferase activity, alcohol group as acceptor
GO:0140096	0.944	catalytic activity, acting on a protein
GO:0004672	0.911	protein kinase activity
GO:0004674	0.878	protein serine/threonine kinase activity
GO:0043167	0.466	ion binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0048513	0.975	animal organ development
GO:0050789	0.959	regulation of biological process
GO:0050794	0.953	regulation of cellular process
GO:0048518	0.913	positive regulation of biological process
GO:0031214	0.875	biomineral tissue development
GO:0042476	0.872	odontogenesis
GO:0042475	0.861	odontogenesis of dentin-containing tooth
GO:0009987	0.808	cellular process
GO:0019222	0.782	regulation of metabolic process
GO:0060255	0.771	regulation of macromolecule metabolic process
GO:0051171	0.761	regulation of nitrogen compound metabolic process
GO:0080090	0.759	regulation of primary metabolic process
GO:0051174	0.733	regulation of phosphorus metabolic process
GO:0051246	0.646	regulation of protein metabolic process
GO:0031399	0.579	regulation of protein modification process
GO:0048522	0.533	positive regulation of cellular process
GO:0071704	0.518	organic substance metabolic process
GO:0042325	0.486	regulation of phosphorylation
GO:0009893	0.435	positive regulation of metabolic process
GO:0044238	0.429	primary metabolic process
GO:0051173	0.410	positive regulation of nitrogen compound metabolic process
GO:0031325	0.409	positive regulation of cellular metabolic process
GO:0044237	0.400	cellular metabolic process
GO:0006807	0.373	nitrogen compound metabolic process
GO:0010604	0.310	positive regulation of macromolecule metabolic process
GO:0001932	0.304	regulation of protein phosphorylation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005794	1.000	Golgi apparatus
GO:0005615	0.998	extracellular space
GO:0031982	0.739	vesicle
GO:0070062	0.717	extracellular exosome
GO:0005783	0.519	endoplasmic reticulum

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.7.1.-	0.990	Phosphotransferases with an alcohol group as acceptor.

[back to server]