StarFunc result for job id Q96MM3

User Input

>input (310 residues)
MSQQLKKRAKTRHQKGLGGRAPSGAKPRQGKSSQDLQAEIEPVSAVWALCDGYVCYEPGP
QALGGDDFSDCYIECVIRGEFSQPILEEDSLFESLEYLKKGSEQQLSQKVFEASSLECSL
EYMKKGVKKELPQKIVGENSLEYSEYMTGKKLPPGGIPGIDLSDPKQLAEFARKKPPINK
EYDSLSAIACPQSGCTRKLRNRAALRKHLLIHGPRDHVCAECGKAFVESSKLKRHFLVHT
GEKPFRCTFEGCGKRFSLDFNLRTHVRIHTGEKRFVCPFQGCNRRFIQSNNLKAHILTHA
NTNKNEQEGK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q96MM3	1.000	1.000	7.258E-55	310	1.000	1.000	Q96MM3.pdb.gz	ZFP42_HUMAN Zinc finger protein 42 homolog OS=Homo sapiens OX=9606 GN=ZFP42 PE=1 SV=2
2	AFDB:Q7T1S3	0.388	0.338	9.673E-24	357	0.484	0.420	Q7T1S3.pdb.gz	Q7T1S3_DANRE Transcription factor YY1 OS=Danio rerio OX=7955 GN=fb59g10 PE=2 SV=1
3	AFDB:F1NHV6	0.388	0.289	1.160E-23	420	0.477	0.352	F1NHV6.pdb.gz	F1NHV6_CHICK YY2 transcription factor OS=Gallus gallus OX=9031 GN=YY2 PE=1 SV=2
4	AFDB:Q3TTC2	0.380	0.314	1.773E-23	378	0.426	0.349	Q3TTC2.pdb.gz	TYY2_MOUSE Transcription factor YY2 OS=Mus musculus OX=10090 GN=Yy2 PE=2 SV=1
5	AFDB:A9JTF5	0.388	0.341	1.883E-23	354	0.481	0.421	A9JTF5.pdb.gz
6	AFDB:P25490	0.384	0.289	3.668E-23	414	0.474	0.355	P25490.pdb.gz	TYY1_HUMAN Transcriptional repressor protein YY1 OS=Homo sapiens OX=9606 GN=YY1 PE=1 SV=2
7	AFDB:P22227	0.380	0.407	1.027E-22	288	0.510	0.549	P22227.pdb.gz	ZFP42_MOUSE Zinc finger protein 42 OS=Mus musculus OX=10090 GN=Zfp42 PE=1 SV=1
8	AFDB:O15391	0.393	0.332	8.053E-21	372	0.432	0.360	O15391.pdb.gz	TYY2_HUMAN Transcription factor YY2 OS=Homo sapiens OX=9606 GN=YY2 PE=2 SV=1
9	AFDB:Q8ST83	0.374	0.230	1.564E-15	520	0.358	0.213	Q8ST83.pdb.gz	PHO_DROME Polycomb protein PHO OS=Drosophila melanogaster OX=7227 GN=pho PE=1 SV=2
10	AFDB:Q9VSZ3	0.358	0.167	2.695E-13	669	0.300	0.139	Q9VSZ3.pdb.gz	Q9VSZ3_DROME LD31045p OS=Drosophila melanogaster OX=7227 GN=phol PE=1 SV=2
11	PDB:4e0iA	0.078	0.116	2.689	152	0.087	0.178	4e0iA.pdb.gz	Structure of yeast sulfhydryl oxidase erv1 reveals electron transfer of the disulfide relay system in the mitochondrial intermembrane space
12	PDB:7suk6	0.075	0.071	3.035	277	0.074	0.083	7suk6.pdb.gz	Artificial intelligence-assisted cryoEM structure of Bfr2-Lcp5 complex observed in the yeast small subunit processome.
13	PDB:6vp9B	0.094	0.046	3.224	914	0.110	0.037	6vp9B.pdb.gz	Molecular basis for N-terminal alpha-synuclein acetylation by human NatB.
14	PDB:6wotA	0.093	0.014	3.867	4197	0.084	0.006	6wotA.pdb.gz	Structural mechanism of two gain-of-function cardiac and skeletal RyR mutations at an equivalent site by cryo-EM.
15	PDB:4yrvA	0.077	0.081	4.365	288	0.084	0.090	4yrvA.pdb.gz	Structural insights into HetR-PatS interaction involved in cyanobacterial pattern formation
16	PDB:4etsB	0.058	0.106	4.638	149	0.068	0.141	4etsB.pdb.gz	Structure and regulon of Campylobacter jejuni ferric uptake regulator Fur define apo-Fur regulation.
17	PDB:7ae1M	0.067	0.061	4.638	400	0.135	0.105	7ae1M.pdb.gz	Cryo-EM structures of human RNA polymerase III in its unbound and transcribing states.
18	PDB:5fj9O	0.086	0.061	5.235	528	0.123	0.072	5fj9O.pdb.gz	Molecular Structures of Unbound and Transcribing RNA Polymerase III.
19	PDB:7dvqM	0.058	0.083	5.235	191	0.110	0.178	7dvqM.pdb.gz	Structure of the activated human minor spliceosome.
20	PDB:7ad8I	0.085	0.109	5.562	206	0.097	0.146	7ad8I.pdb.gz	The TFIIH subunits p44/p62 act as a damage sensor during nucleotide excision repair.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q96MM3	0.0	640	310	1.000	1.000	ZFP42_HUMAN Zinc finger protein 42 homolog OS=Homo sapiens OX=9606 GN=ZFP42 PE=1 SV=2
2	P22227	2.68e-98	293	288	0.526	0.566	ZFP42_MOUSE Zinc finger protein 42 OS=Mus musculus OX=10090 GN=Zfp42 PE=1 SV=1
3	Q7T304	2.54e-94	285	354	0.445	0.390	Q7T304_DANRE YY1 transcription factor b OS=Danio rerio OX=7955 GN=fb68e12 PE=2 SV=1
4	Q7T1S3	2.79e-94	285	357	0.455	0.395	Q7T1S3_DANRE Transcription factor YY1 OS=Danio rerio OX=7955 GN=fb59g10 PE=2 SV=1
5	P25490	3.17e-93	284	414	0.452	0.338	TYY1_HUMAN Transcriptional repressor protein YY1 OS=Homo sapiens OX=9606 GN=YY1 PE=1 SV=2
6	Q8CHJ4	4.37e-93	284	411	0.452	0.341	Q8CHJ4_RAT Transcription factor YY1 OS=Rattus norvegicus OX=10116 GN=Yy1 PE=1 SV=1
7	Q00899	4.78e-93	284	414	0.452	0.338	TYY1_MOUSE Transcriptional repressor protein YY1 OS=Mus musculus OX=10090 GN=Yy1 PE=1 SV=1
8	Q5ZMN5	6.88e-93	283	420	0.448	0.331	Q5ZMN5_CHICK C2H2-type domain-containing protein OS=Gallus gallus OX=9031 GN=RCJMB04_1i20 PE=2 SV=1
9	F1NHV6	8.54e-93	283	420	0.448	0.331	F1NHV6_CHICK YY2 transcription factor OS=Gallus gallus OX=9031 GN=YY2 PE=1 SV=2
10	A0A8I6A7Q7	7.37e-83	257	403	0.413	0.318	A0A8I6A7Q7_RAT YY1 transcription factor OS=Rattus norvegicus OX=10116 GN=Yy1 PE=1 SV=1
11	Q3TTC2	2.63e-82	255	378	0.413	0.339	TYY2_MOUSE Transcription factor YY2 OS=Mus musculus OX=10090 GN=Yy2 PE=2 SV=1
12	O15391	3.86e-82	254	372	0.406	0.339	TYY2_HUMAN Transcription factor YY2 OS=Homo sapiens OX=9606 GN=YY2 PE=2 SV=1
13	Q8ST83	3.35e-61	204	520	0.290	0.173	PHO_DROME Polycomb protein PHO OS=Drosophila melanogaster OX=7227 GN=pho PE=1 SV=2
14	Q9VSZ3	1.10e-50	179	669	0.248	0.115	Q9VSZ3_DROME LD31045p OS=Drosophila melanogaster OX=7227 GN=phol PE=1 SV=2
15	Q2V3L3	3.57e-34	130	387	0.184	0.147	YY1_ARATH Zinc finger transcription factor YY1 OS=Arabidopsis thaliana OX=3702 GN=YY1 PE=1 SV=1
16	A0A0B5H7U7	6.30e-23	101	722	0.155	0.066	A0A0B5H7U7_DANRE Metal regulatory transcription factor 1 isoform X2 OS=Danio rerio OX=7955 GN=MTF-1 PE=2 SV=1
17	Q8QGH4	6.81e-23	100	593	0.155	0.081	Q8QGH4_DANRE Metal regulatory transcription factor 1 OS=Danio rerio OX=7955 GN=MTF-1 PE=2 SV=1
18	A0A0G2KFP7	7.38e-23	100	749	0.155	0.064	A0A0G2KFP7_DANRE Metal regulatory transcription factor 1 isoform X1 OS=Danio rerio OX=7955 GN=MTF-1 PE=4 SV=2
19	Q14872	1.08e-22	100	753	0.152	0.062	MTF1_HUMAN Metal regulatory transcription factor 1 OS=Homo sapiens OX=9606 GN=MTF1 PE=1 SV=2
20	Q07243	1.13e-22	100	675	0.152	0.070	MTF1_MOUSE Metal regulatory transcription factor 1 OS=Mus musculus OX=10090 GN=Mtf1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01485 IBR	6.4e+02	11.9	IBR domain, a half RING-finger domain
2	PF00096 zf-C2H2	3.3e-13	60.4	Zinc finger, C2H2 type
3	PF13894 zf-C2H2_4	2.2e-08	45.2	C2H2-type zinc finger
4	PF17017 zf-C2H2_aberr	3e+02	13.0	Aberrant zinc-finger
5	PF12171 zf-C2H2_jaz	1.6e+02	14.0	Zinc-finger double-stranded RNA-binding
6	PF13465 zf-H2C2_2	6.7e-13	59.6	Zinc-finger double domain
7	PF13909 zf-H2C2_5	0.36	21.9	C2H2-type zinc-finger domain
8	PF02176 zf-TRAF	3.8	19.6	TRAF-type zinc finger
9	PF18408 zf_Hakai	33	15.6	C2H2 Hakai zinc finger domain
10	PF14369 zinc_ribbon_9	40	15.9	zinc-ribbon

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000317686

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000259915	0.836	POU domain, class 5, transcription factor 1
2	9606.ENSP00000229307	0.833	Homeobox protein NANOG
3	9606.ENSP00000422488	0.766	Steroid hormone receptor ERR2
4	9606.ENSP00000356480	0.746	E3 ubiquitin-protein ligase RING2
5	9606.ENSP00000263360	0.732	Polycomb protein EED
6	9606.ENSP00000323588	0.723	Transcription factor SOX-2
7	9606.ENSP00000316578	0.709	Polycomb protein SUZ12
8	9606.ENSP00000363787	0.701	E3 ubiquitin-protein ligase RING1
9	9606.ENSP00000305906	0.699	Undifferentiated embryonic cell transcription factor 1
10	9606.ENSP00000440674	0.691	Polyhomeotic-like protein 1
11	9606.ENSP00000296145	0.677	Teratocarcinoma-derived growth factor 1
12	9606.ENSP00000368253	0.673	Nuclear receptor subfamily 0 group B member 1
13	9606.ENSP00000335306	0.670	Developmental pluripotency-associated protein 4
14	9606.ENSP00000311697	0.665	Fibroblast growth factor 5
15	9606.ENSP00000359396	0.658	Developmental pluripotency-associated 5 protein
16	9606.ENSP00000417710	0.650	Developmental pluripotency-associated protein 2
17	9606.ENSP00000257566	0.642	T-box transcription factor TBX3
18	9606.ENSP00000320147	0.638	Histone-lysine N-methyltransferase EZH2
19	9606.ENSP00000263707	0.637	Transcription factor CP2-like protein 1
20	9606.ENSP00000331745	0.633	Growth/differentiation factor 3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:1990837	1.000	sequence-specific double-stranded DNA binding
GO:0140110	0.898	transcription regulator activity
GO:0000981	0.874	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0000976	0.634	transcription cis-regulatory region binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0032502	0.986	developmental process
GO:0032501	0.976	multicellular organismal process
GO:0048856	0.975	anatomical structure development
GO:0007275	0.913	multicellular organism development
GO:0050789	0.911	regulation of biological process
GO:0050794	0.900	regulation of cellular process
GO:0060255	0.881	regulation of macromolecule metabolic process
GO:0080090	0.879	regulation of primary metabolic process
GO:0010468	0.856	regulation of gene expression
GO:0031323	0.841	regulation of cellular metabolic process
GO:0048731	0.838	system development
GO:0051171	0.825	regulation of nitrogen compound metabolic process
GO:0009889	0.803	regulation of biosynthetic process
GO:0048513	0.795	animal organ development
GO:0019219	0.779	regulation of nucleobase-containing compound metabolic process
GO:0010556	0.751	regulation of macromolecule biosynthetic process
GO:0031326	0.748	regulation of cellular biosynthetic process
GO:0051252	0.739	regulation of RNA metabolic process
GO:0006355	0.727	regulation of DNA-templated transcription
GO:0045137	0.717	development of primary sexual characteristics
GO:0008406	0.674	gonad development
GO:0046661	0.603	male sex differentiation
GO:0046660	0.555	female sex differentiation
GO:0048522	0.506	positive regulation of cellular process
GO:0046546	0.500	development of primary male sexual characteristics
GO:0009893	0.455	positive regulation of metabolic process
GO:0010604	0.449	positive regulation of macromolecule metabolic process
GO:0008584	0.419	male gonad development
GO:0046545	0.416	development of primary female sexual characteristics
GO:0009987	0.355	cellular process
GO:0051173	0.351	positive regulation of nitrogen compound metabolic process
GO:0031325	0.341	positive regulation of cellular metabolic process
GO:0048519	0.324	negative regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.996	cytoplasm
GO:0005634	0.990	nucleus
GO:0070013	0.988	intracellular organelle lumen
GO:0031981	0.974	nuclear lumen
GO:0032991	0.933	protein-containing complex
GO:0043232	0.603	intracellular non-membrane-bounded organelle
GO:0005654	0.530	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]