StarFunc result for job id Q96MN2

User Input

>input (994 residues)
MAASFFSDFGLMWYLEELKKEEFRKFKEHLKQMTLQLELKQIPWTEVKKASREELANLLI
KHYEEQQAWNITLRIFQKMDRKDLCMKVMRERTGYTKTYQAHAKQKFSRLWSSKSVTEIH
LYFEEEVKQEECDHLDRLFAPKEAGKQPRTVIIQGPQGIGKTTLLMKLMMAWSDNKIFRD
RFLYTFYFCCRELRELPPTSLADLISREWPDPAAPITEIVSQPERLLFVIDSFEELQGGL
NEPDSDLCGDLMEKRPVQVLLSSLLRKKMLPEASLLIAIKPVCPKELRDQVTISEIYQPR
GFNESDRLVYFCCFFKDPKRAMEAFNLVRESEQLFSICQIPLLCWILCTSLKQEMQKGKD
LALTCQSTTSVYSSFVFNLFTPEGAEGPTPQTQHQLKALCSLAAEGMWTDTFEFCEDDLR
RNGVVDADIPALLGTKILLKYGERESSYVFLHVCIQEFCAALFYLLKSHLDHPHPAVRCV
QELLVANFEKARRAHWIFLGCFLTGLLNKKEQEKLDAFFGFQLSQEIKQQIHQCLKSLGE
RGNPQGQVDSLAIFYCLFEMQDPAFVKQAVNLLQEANFHIIDNVDLVVSAYCLKYCSSLR
KLCFSVQNVFKKEDEHSSTSDYSLICWHHICSVLTTSGHLRELQVQDSTLSESTFVTWCN
QLRHPSCRLQKLGINNVSFSGQSVLLFEVLFYQPDLKYLSFTLTKLSRDDIRSLCDALNY
PAGNVKELALVNCHLSPIDCEVLAGLLTNNKKLTYLNVSCNQLDTGVPLLCEALCSPDTV
LVYLMLAFCHLSEQCCEYISEMLLRNKSVRYLDLSANVLKDEGLKTLCEALKHPDCCLDS
LCLVKCFITAAGCEDLASALISNQNLKILQIGCNEIGDVGVQLLCRALTHTDCRLEILGL
EECGLTSTCCKDLASVLTCSKTLQQLNLTLNTLDHTGVVVLCEALRHPECALQVLGLRKT
DFDEETQALLTAEEERNPNLTITDDCDTITRVEI

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q96MN2	1.000	1.000	0.000	994	1.000	1.000	Q96MN2.pdb.gz	NALP4_HUMAN NACHT, LRR and PYD domains-containing protein 4 OS=Homo sapiens OX=9606 GN=NLRP4 PE=1 SV=3
2	AFDB:Q3UWL9	0.791	0.831	3.462E-87	944	0.445	0.468	Q3UWL9.pdb.gz	Q3UWL9_MOUSE NACHT, LRR and PYD domains-containing protein 4F OS=Mus musculus OX=10090 GN=Nlrp4g PE=2 SV=1
3	AFDB:Q7RTR0	0.797	0.799	3.174E-82	991	0.412	0.414	Q7RTR0.pdb.gz	NLRP9_HUMAN NACHT, LRR and PYD domains-containing protein 9 OS=Homo sapiens OX=9606 GN=NLRP9 PE=1 SV=1
4	AFDB:Q86W24	0.699	0.644	3.470E-77	1093	0.411	0.374	Q86W24.pdb.gz	NAL14_HUMAN NACHT, LRR and PYD domains-containing protein 14 OS=Homo sapiens OX=9606 GN=NLRP14 PE=1 SV=1
5	AFDB:Q66X22	0.718	0.712	5.208E-70	1003	0.359	0.356	Q66X22.pdb.gz	NLR9B_MOUSE NACHT, LRR and PYD domains-containing protein 9B OS=Mus musculus OX=10090 GN=Nlrp9b PE=1 SV=1
6	AFDB:P59047	0.703	0.597	8.908E-68	1200	0.332	0.275	P59047.pdb.gz	NALP5_HUMAN NACHT, LRR and PYD domains-containing protein 5 OS=Homo sapiens OX=9606 GN=NLRP5 PE=1 SV=2
7	AFDB:Q66X03	0.640	0.666	1.140E-66	949	0.329	0.345	Q66X03.pdb.gz	NLR9A_MOUSE NACHT, LRR and PYD domains-containing protein 9A OS=Mus musculus OX=10090 GN=Nlrp9a PE=1 SV=1
8	AFDB:Q66X01	0.742	0.735	2.203E-66	1004	0.339	0.336	Q66X01.pdb.gz	NLR9C_MOUSE NACHT, LRR and PYD domains-containing protein 9C OS=Mus musculus OX=10090 GN=Nlrp9c PE=2 SV=1
9	AFDB:P59045	0.692	0.670	3.216E-65	1033	0.335	0.322	P59045.pdb.gz	NAL11_HUMAN NACHT, LRR and PYD domains-containing protein 11 OS=Homo sapiens OX=9606 GN=NLRP11 PE=2 SV=2
10	AFDB:P59046	0.582	0.551	4.186E-65	1061	0.346	0.324	P59046.pdb.gz	NAL12_HUMAN NACHT, LRR and PYD domains-containing protein 12 OS=Homo sapiens OX=9606 GN=NLRP12 PE=1 SV=2
11	PDB:7pzcA	0.482	0.476	7.693E-48	1010	0.339	0.334	7pzcA.pdb.gz	Structure of the NLRP3 decamer bound to the cytokine release inhibitor CRID3.
12	PDB:7lfhA	0.447	0.513	1.165E-38	806	0.298	0.367	7lfhA.pdb.gz
13	PDB:6npyA	0.427	0.507	5.776E-34	798	0.284	0.353	6npyA.pdb.gz	Structural mechanism for NEK7-licensed activation of NLRP3 inflammasome.
14	PDB:1a4yA	0.372	0.769	2.604E-21	460	0.124	0.267	1a4yA.pdb.gz
15	PDB:4kxfP	0.425	0.475	8.531E-21	866	0.144	0.165	4kxfP.pdb.gz	Crystal structure of NLRC4 reveals its autoinhibition mechanism
16	PDB:3jblA	0.301	0.325	8.542E-16	909	0.141	0.154	3jblA.pdb.gz
17	PDB:6b5bA	0.277	0.235	1.527E-13	1199	0.157	0.130	6b5bA.pdb.gz
18	PDB:5yudA	0.297	0.253	1.248E-9	1238	0.167	0.134	5yudA.pdb.gz	Structural basis for specific flagellin recognition by the NLR protein NAIP5.
19	PDB:6o60C	0.266	0.585	4.666E-9	389	0.078	0.201	6o60C.pdb.gz	GGTase3 is a newly identified geranylgeranyltransferase targeting a ubiquitin ligase.
20	PDB:2p1nB	0.240	0.380	7.436E-8	571	0.069	0.121	2p1nB.pdb.gz	Mechanism of auxin perception by the TIR1 ubiquitin ligase

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P59045	0.0	566	1033	0.345	0.332	NAL11_HUMAN NACHT, LRR and PYD domains-containing protein 11 OS=Homo sapiens OX=9606 GN=NLRP11 PE=2 SV=2
2	Q3UWL9	0.0	879	944	0.450	0.474	Q3UWL9_MOUSE NACHT, LRR and PYD domains-containing protein 4F OS=Mus musculus OX=10090 GN=Nlrp4g PE=2 SV=1
3	Q66JP4	0.0	691	738	0.349	0.470	Q66JP4_MOUSE NLR family, pyrin domain containing 4G OS=Mus musculus OX=10090 GN=Nlrp4g PE=2 SV=1
4	Q66X05	0.0	787	959	0.401	0.416	NAL4F_MOUSE NACHT, LRR and PYD domains-containing protein 4F OS=Mus musculus OX=10090 GN=Nlrp4f PE=1 SV=1
5	Q66X22	0.0	577	1003	0.365	0.362	NLR9B_MOUSE NACHT, LRR and PYD domains-containing protein 9B OS=Mus musculus OX=10090 GN=Nlrp9b PE=1 SV=1
6	Q7RTR0	0.0	766	991	0.415	0.417	NLRP9_HUMAN NACHT, LRR and PYD domains-containing protein 9 OS=Homo sapiens OX=9606 GN=NLRP9 PE=1 SV=1
7	Q86W24	0.0	721	1093	0.413	0.376	NAL14_HUMAN NACHT, LRR and PYD domains-containing protein 14 OS=Homo sapiens OX=9606 GN=NLRP14 PE=1 SV=1
8	Q96MN2	0.0	2041	994	1.000	1.000	NALP4_HUMAN NACHT, LRR and PYD domains-containing protein 4 OS=Homo sapiens OX=9606 GN=NLRP4 PE=1 SV=3
9	Q66X03	4.03e-177	542	949	0.334	0.350	NLR9A_MOUSE NACHT, LRR and PYD domains-containing protein 9A OS=Mus musculus OX=10090 GN=Nlrp9a PE=1 SV=1
10	Q66X01	3.99e-171	528	1004	0.346	0.343	NLR9C_MOUSE NACHT, LRR and PYD domains-containing protein 9C OS=Mus musculus OX=10090 GN=Nlrp9c PE=2 SV=1
11	P59046	5.34e-169	524	1061	0.346	0.324	NAL12_HUMAN NACHT, LRR and PYD domains-containing protein 12 OS=Homo sapiens OX=9606 GN=NLRP12 PE=1 SV=2
12	D4A523	3.56e-160	500	1035	0.350	0.336	NLRP3_RAT NACHT, LRR and PYD domains-containing protein 3 OS=Rattus norvegicus OX=10116 GN=Nlrp3 PE=3 SV=2
13	Q8R4B8	7.80e-160	499	1033	0.344	0.331	NLRP3_MOUSE NACHT, LRR and PYD domains-containing protein 3 OS=Mus musculus OX=10090 GN=Nlrp3 PE=1 SV=1
14	Q96P20	7.57e-158	494	1036	0.312	0.299	NLRP3_HUMAN NACHT, LRR and PYD domains-containing protein 3 OS=Homo sapiens OX=9606 GN=NLRP3 PE=1 SV=3
15	Q9NX02	1.99e-155	489	1062	0.352	0.330	NALP2_HUMAN NACHT, LRR and PYD domains-containing protein 2 OS=Homo sapiens OX=9606 GN=NLRP2 PE=1 SV=1
16	J3KN39	4.63e-154	485	1059	0.350	0.329	J3KN39_HUMAN NACHT, LRR and PYD domains-containing protein 2 OS=Homo sapiens OX=9606 GN=NLRP2 PE=1 SV=1
17	P59047	3.24e-152	484	1200	0.317	0.263	NALP5_HUMAN NACHT, LRR and PYD domains-containing protein 5 OS=Homo sapiens OX=9606 GN=NLRP5 PE=1 SV=2
18	F1MT67	5.15e-152	481	1098	0.318	0.288	F1MT67_BOVIN NLR family pyrin domain containing 5 OS=Bos taurus OX=9913 GN=NLRP5 PE=3 SV=3
19	Q647I9	1.85e-151	479	1098	0.317	0.287	NALP5_BOVIN NACHT, LRR and PYD domains-containing protein 5 OS=Bos taurus OX=9913 GN=NLRP5 PE=2 SV=1
20	E9Q5R7	1.05e-147	468	1054	0.326	0.307	NAL12_MOUSE NACHT, LRR and PYD domains-containing protein 12 OS=Mus musculus OX=10090 GN=Nlrp12 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13173 AAA_14	1.3e+02	14.0	AAA domain
2	PF13191 AAA_16	0.043	25.7	AAA ATPase domain
3	PF13401 AAA_22	1.5e+02	14.1	AAA domain
4	PF13481 AAA_25	3.1e+02	12.3	AAA domain
5	PF13604 AAA_30	5.5e+02	11.7	AAA domain
6	PF10236 DAP3	2.1e+02	12.5	Mitochondrial ribosomal death-associated protein 3
7	PF07261 DnaB_2	1.8e+02	13.3	Replication initiation and membrane attachment
8	PF13516 LRR_6	3.9e-09	46.9	Leucine Rich repeat
9	PF13855 LRR_8	3.6e+02	12.3	Leucine rich repeat
10	PF05729 NACHT	1.4e-43	160.2	NACHT domain
11	PF17776 NLRC4_HD2	4.9e-21	87.1	NLRC4 helical domain HD2
12	PF17779 NOD2_WH	1.2e-10	52.8	NOD2 winged helix domain
13	PF02758 PYRIN	1.2e-24	97.6	PAAD/DAPIN/Pyrin domain
14	PF04851 ResIII	2e+02	13.4	Type III restriction enzyme, res subunit
15	PF00910 RNA_helicase	5.4e+02	12.4	RNA helicase
16	PF05272 VirE	22	16.0	Virulence-associated protein E

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000301295

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000355231	0.987	Beclin-1
2	9606.ENSP00000227451	0.984	E3 ubiquitin-protein ligase DTX4
3	9606.ENSP00000304697	0.901	Polyubiquitin-B
4	9606.ENSP00000272317	0.900	Ubiquitin-40S ribosomal protein S27a
5	9606.ENSP00000388107	0.900	Ubiquitin-60S ribosomal protein L40
6	9606.ENSP00000441543	0.900	Polyubiquitin-C
7	9606.ENSP00000433138	0.898	Caspase-1
8	9606.ENSP00000329967	0.880	Serine/threonine-protein kinase TBK1
9	9606.ENSP00000247470	0.878	Apoptosis-associated speck-like protein containing a CARD
10	9606.ENSP00000428657	0.852	Baculoviral IAP repeat-containing protein 1
11	9606.ENSP00000471896	0.707	Interferon regulatory factor 3
12	9606.ENSP00000385090	0.690	NLR family CARD domain-containing protein 4
13	9606.ENSP00000331288	0.688	Stimulator of interferon genes protein
14	9606.ENSP00000359424	0.615	Inhibitor of nuclear factor kappa-B kinase subunit alpha
15	9606.ENSP00000360215	0.600	Z-DNA-binding protein 1
16	9606.ENSP00000335153	0.594	Heat shock protein HSP 90-alpha
17	9606.ENSP00000357112	0.568	Interferon-inducible protein AIM2
18	9606.ENSP00000367208	0.553	Protein SGT1 homolog
19	9606.ENSP00000219596	0.549	Pyrin

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0003676	0.663	nucleic acid binding
GO:0097367	0.431	carbohydrate derivative binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050789	0.992	regulation of biological process
GO:0009987	0.979	cellular process
GO:0019222	0.979	regulation of metabolic process
GO:0051239	0.977	regulation of multicellular organismal process
GO:0060255	0.970	regulation of macromolecule metabolic process
GO:0010468	0.963	regulation of gene expression
GO:0048518	0.941	positive regulation of biological process
GO:0001817	0.940	regulation of cytokine production
GO:0050794	0.923	regulation of cellular process
GO:0010604	0.901	positive regulation of macromolecule metabolic process
GO:0030162	0.855	regulation of proteolysis
GO:0032652	0.847	regulation of interleukin-1 production
GO:0051173	0.803	positive regulation of nitrogen compound metabolic process
GO:0032651	0.778	regulation of interleukin-1 beta production
GO:0050896	0.771	response to stimulus
GO:0048583	0.771	regulation of response to stimulus
GO:0051240	0.760	positive regulation of multicellular organismal process
GO:0065009	0.741	regulation of molecular function
GO:0001819	0.737	positive regulation of cytokine production
GO:0031323	0.715	regulation of cellular metabolic process
GO:0048522	0.693	positive regulation of cellular process
GO:0050790	0.684	regulation of catalytic activity
GO:0044419	0.607	biological process involved in interspecies interaction between organisms
GO:0051336	0.497	regulation of hydrolase activity
GO:0009605	0.493	response to external stimulus
GO:0006950	0.481	response to stress
GO:0009607	0.475	response to biotic stimulus
GO:0051247	0.474	positive regulation of protein metabolic process
GO:0051707	0.473	response to other organism
GO:0044093	0.468	positive regulation of molecular function
GO:0010556	0.462	regulation of macromolecule biosynthetic process
GO:0031326	0.458	regulation of cellular biosynthetic process
GO:0051252	0.458	regulation of RNA metabolic process
GO:0006355	0.453	regulation of DNA-templated transcription
GO:0051716	0.452	cellular response to stimulus
GO:0052547	0.442	regulation of peptidase activity
GO:0023051	0.428	regulation of signaling
GO:0048519	0.427	negative regulation of biological process
GO:0010646	0.418	regulation of cell communication
GO:0010033	0.413	response to organic substance
GO:0009966	0.412	regulation of signal transduction
GO:0006952	0.400	defense response
GO:0051090	0.379	regulation of DNA-binding transcription factor activity
GO:2000116	0.372	regulation of cysteine-type endopeptidase activity
GO:0008152	0.367	metabolic process
GO:0048584	0.356	positive regulation of response to stimulus
GO:0002376	0.346	immune system process
GO:0071704	0.333	organic substance metabolic process
GO:0071840	0.331	cellular component organization or biogenesis
GO:0043085	0.322	positive regulation of catalytic activity
GO:0031347	0.320	regulation of defense response
GO:0032101	0.300	regulation of response to external stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.996	cytosol
GO:0043231	0.870	intracellular membrane-bounded organelle
GO:0032991	0.764	protein-containing complex
GO:0005654	0.388	nucleoplasm
GO:0012505	0.382	endomembrane system

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]