StarFunc result for job id Q96MN5

User Input

>input (208 residues)
MDKFVIRTPRIQNSPQKKDSGGKVYKQATIESLKRVVVVEDIKRWKTMLELPDQTKENLV
EALQELKKKIPSREVLKSTRIGHTVNKMRKHSDSEVASLAREVYTEWKTFTEKHSNRPSI
EVRSDPKTESLRKNAQKLLSEALELKMDHLLVENIERETFHLCSRLINGPYRRTVRALVF
TLKHRAEIRAQVKSGSLPVGTFVQTHKK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q96MN5	1.000	1.000	3.196E-29	208	1.000	1.000	Q96MN5.pdb.gz	TEAN2_HUMAN Transcription elongation factor A N-terminal and central domain-containing protein 2 OS=Homo sapiens OX=9606 GN=TCEANC2 PE=1 SV=1
2	AFDB:P49373	0.375	0.270	1.013E-6	293	0.207	0.147	P49373.pdb.gz	TFS2_SCHPO Transcription elongation factor S-II OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=tfs1 PE=3 SV=1
3	AFDB:Q15560	0.351	0.248	5.135E-6	299	0.226	0.157	Q15560.pdb.gz	TCEA2_HUMAN Transcription elongation factor A protein 2 OS=Homo sapiens OX=9606 GN=TCEA2 PE=1 SV=1
4	AFDB:A0A1W2PPZ5	0.329	0.229	3.331E-5	301	0.236	0.163	A0A1W2PPZ5.pdb.gz	A0A1W2PPZ5_HUMAN Transcription elongation factor (Fragment) OS=Homo sapiens OX=9606 GN=TCEA1 PE=1 SV=1
5	AFDB:Q63799	0.342	0.244	3.675E-5	299	0.221	0.154	Q63799.pdb.gz	TCEA2_RAT Transcription elongation factor A protein 2 OS=Rattus norvegicus OX=10116 GN=Tcea2 PE=2 SV=1
6	AFDB:P07273	0.355	0.244	9.360E-5	309	0.168	0.113	P07273.pdb.gz	TFS2_YEAST Transcription elongation factor S-II OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DST1 PE=1 SV=4
7	AFDB:O75764	0.345	0.213	5.502E-4	348	0.255	0.152	O75764.pdb.gz	TCEA3_HUMAN Transcription elongation factor A protein 3 OS=Homo sapiens OX=9606 GN=TCEA3 PE=1 SV=2
8	AFDB:Q586X9	0.344	0.166	4.345E-3	467	0.192	0.086	Q586X9.pdb.gz	Q586X9_TRYB2 Transcription elongation factor S-II, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=28H13.140 PE=1 SV=1
9	AFDB:Q86VL0	0.351	0.304	1.003E-2	242	0.192	0.165	Q86VL0.pdb.gz	Q86VL0_HUMAN TCEA2 protein OS=Homo sapiens OX=9606 GN=TCEA2 PE=1 SV=1
10	AFDB:Q14241	0.317	0.089	1.347E-2	798	0.139	0.036	Q14241.pdb.gz	ELOA1_HUMAN Elongin-A OS=Homo sapiens OX=9606 GN=ELOA PE=1 SV=2
11	PDB:5iy6U	0.333	0.403	2.493E-1	170	0.101	0.124	5iy6U.pdb.gz	Near-atomic resolution visualization of human transcription promoter opening.
12	PDB:1wa5B	0.269	0.128	4.727E-1	466	0.101	0.045	1wa5B.pdb.gz	Structural basis for the assembly of a nuclear export complex.
13	PDB:4d4zB	0.274	0.203	6.045E-1	290	0.125	0.090	4d4zB.pdb.gz	Crystal Structure of the Peroxo-Diiron(III) Intermediate of Deoxyhypusine Hydroxylase, an Oxygenase Involved in Hypusination.
14	PDB:5n2sA	0.203	0.133	1.328	383	0.091	0.050	5n2sA.pdb.gz	Structures of Human A1 and A2A Adenosine Receptors with Xanthines Reveal Determinants of Selectivity.
15	PDB:3zhpA	0.260	0.183	1.395	315	0.159	0.105	3zhpA.pdb.gz
16	PDB:7ajtUO	0.206	0.103	1.540	493	0.149	0.063	7ajtUO.pdb.gz	Structure of the Maturing 90S Pre-ribosome in Association with the RNA Exosome.
17	PDB:4k80A	0.122	0.121	1.699	209	0.135	0.134	4k80A.pdb.gz	Non-vesicular trafficking by a ceramide-1-phosphate transfer protein regulates eicosanoids.
18	PDB:4tnmA	0.255	0.137	1.699	407	0.096	0.049	4tnmA.pdb.gz
19	PDB:7zs9M	0.211	0.154	1.699	310	0.130	0.087	7zs9M.pdb.gz	Structures of transcription preinitiation complex engaged with the +1 nucleosome.
20	PDB:5iy7M	0.170	0.124	1.969	310	0.101	0.068	5iy7M.pdb.gz	Near-atomic resolution visualization of human transcription promoter opening.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q96MN5	3.37e-153	424	208	1.000	1.000	TEAN2_HUMAN Transcription elongation factor A N-terminal and central domain-containing protein 2 OS=Homo sapiens OX=9606 GN=TCEANC2 PE=1 SV=1
2	Q4KLL0	3.48e-05	45.8	301	0.163	0.113	TCEA1_RAT Transcription elongation factor A protein 1 OS=Rattus norvegicus OX=10116 GN=Tcea1 PE=1 SV=1
3	P10711	4.52e-05	45.4	301	0.144	0.100	TCEA1_MOUSE Transcription elongation factor A protein 1 OS=Mus musculus OX=10090 GN=Tcea1 PE=1 SV=2
4	A0A1W2PPZ5	6.81e-05	45.1	301	0.144	0.100	A0A1W2PPZ5_HUMAN Transcription elongation factor (Fragment) OS=Homo sapiens OX=9606 GN=TCEA1 PE=1 SV=1
5	A0A384MTX4	6.94e-05	45.1	301	0.144	0.100	A0A384MTX4_HUMAN Transcription elongation factor OS=Homo sapiens OX=9606 PE=2 SV=1
6	P23193	6.94e-05	45.1	301	0.144	0.100	TCEA1_HUMAN Transcription elongation factor A protein 1 OS=Homo sapiens OX=9606 GN=TCEA1 PE=1 SV=2
7	P49373	1.10e-04	44.3	293	0.139	0.099	TFS2_SCHPO Transcription elongation factor S-II OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=tfs1 PE=3 SV=1
8	Q63799	3.55e-04	42.7	299	0.125	0.087	TCEA2_RAT Transcription elongation factor A protein 2 OS=Rattus norvegicus OX=10116 GN=Tcea2 PE=2 SV=1
9	Q86VL0	6.07e-04	42.0	242	0.106	0.091	Q86VL0_HUMAN TCEA2 protein OS=Homo sapiens OX=9606 GN=TCEA2 PE=1 SV=1
10	Q15560	8.63e-04	41.6	299	0.106	0.074	TCEA2_HUMAN Transcription elongation factor A protein 2 OS=Homo sapiens OX=9606 GN=TCEA2 PE=1 SV=1
11	Q6IB64	8.63e-04	41.6	299	0.106	0.074	Q6IB64_HUMAN Transcription elongation factor OS=Homo sapiens OX=9606 GN=TCEA2 PE=2 SV=1
12	P23881	0.002	40.4	347	0.111	0.066	TCEA3_MOUSE Transcription elongation factor A protein 3 OS=Mus musculus OX=10090 GN=Tcea3 PE=1 SV=3
13	O75764	0.004	39.7	348	0.111	0.066	TCEA3_HUMAN Transcription elongation factor A protein 3 OS=Homo sapiens OX=9606 GN=TCEA3 PE=1 SV=2
14	A0A1W2PRL9	0.058	36.2	280	0.087	0.064	A0A1W2PRL9_HUMAN Transcription elongation factor (Fragment) OS=Homo sapiens OX=9606 GN=TCEA1 PE=1 SV=1
15	Q14241	0.070	36.2	798	0.106	0.028	ELOA1_HUMAN Elongin-A OS=Homo sapiens OX=9606 GN=ELOA PE=1 SV=2
16	P07273	0.079	35.8	309	0.082	0.055	TFS2_YEAST Transcription elongation factor S-II OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DST1 PE=1 SV=4
17	Q1LYS1	0.65	33.1	768	0.115	0.031	Q1LYS1_DANRE Sema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3E OS=Danio rerio OX=7955 GN=fj37c11 PE=3 SV=1
18	F4JCS8	0.72	33.1	1613	0.062	0.008	F4JCS8_ARATH Protein SUO OS=Arabidopsis thaliana OX=3702 GN=SUO PE=1 SV=1
19	Q63187	0.81	33.1	773	0.067	0.018	ELOA1_RAT Elongin-A OS=Rattus norvegicus OX=10116 GN=Eloa PE=1 SV=1
20	Q9VCP0	1.3	32.3	643	0.101	0.033	ELOA1_DROME Transcription elongation factor B polypeptide 3 OS=Drosophila melanogaster OX=7227 GN=EloA PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF08711 Med26	5.6e-09	47.2	TFIIS helical bundle-like domain
2	PF07500 TFIIS_M	0.0077	28.0	Transcription factor S-II (TFIIS), central domain
3	PF17643 TssR	37	13.9	Type VI secretion system, TssR

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000234827

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000470252	0.761	Transcription elongation factor SPT5
2	9606.ENSP00000478303	0.741	DNA-directed RNA polymerases I, II, and III subunit RPABC1
3	9606.ENSP00000219252	0.717	DNA-directed RNA polymerase II subunit RPB3
4	9606.ENSP00000221859	0.717	DNA-directed RNA polymerase II subunit RPB9
5	9606.ENSP00000370625	0.714	DNA-directed RNA polymerase II subunit RPB2
6	9606.ENSP00000295321	0.707	Protein IWS1 homolog
7	9606.ENSP00000272645	0.696	DNA-directed RNA polymerase II subunit RPB4
8	9606.ENSP00000403852	0.684	DNA-directed RNA polymerases I, II, and III subunit RPABC2
9	9606.ENSP00000225504	0.681	Transcription elongation factor SPT4
10	9606.ENSP00000324124	0.681	DNA-directed RNA polymerases I, II, and III subunit RPABC5
11	9606.ENSP00000359531	0.675	Transcription initiation factor IIB
12	9606.ENSP00000331111	0.670	DNA-directed RNA polymerase I subunit RPA12
13	9606.ENSP00000415536	0.658	DNA-directed RNA polymerases I, II, and III subunit RPABC3
14	9606.ENSP00000301788	0.647	DNA-directed RNA polymerase II subunit RPB7
15	9606.ENSP00000170168	0.611	RNA exonuclease 1 homolog
16	9606.ENSP00000366528	0.604	Transmembrane protein 252
17	9606.ENSP00000296328	0.592	UBX domain-containing protein 7
18	9606.ENSP00000342889	0.585	DNA-directed RNA polymerases I, II, and III subunit RPABC4
19	9606.ENSP00000481920	0.575	Mediator of RNA polymerase II transcription subunit 6
20	9606.ENSP00000282292	0.573	Zinc finger protein 773

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0065007	0.990	biological regulation
GO:0050789	0.984	regulation of biological process
GO:0009987	0.983	cellular process
GO:0050794	0.967	regulation of cellular process
GO:0080090	0.967	regulation of primary metabolic process
GO:0071704	0.928	organic substance metabolic process
GO:0044237	0.907	cellular metabolic process
GO:0006807	0.901	nitrogen compound metabolic process
GO:0044238	0.886	primary metabolic process
GO:0031323	0.863	regulation of cellular metabolic process
GO:0043170	0.862	macromolecule metabolic process
GO:0051171	0.829	regulation of nitrogen compound metabolic process
GO:0048518	0.809	positive regulation of biological process
GO:0060255	0.762	regulation of macromolecule metabolic process
GO:0034641	0.694	cellular nitrogen compound metabolic process
GO:1901360	0.693	organic cyclic compound metabolic process
GO:0006725	0.682	cellular aromatic compound metabolic process
GO:0051252	0.677	regulation of RNA metabolic process
GO:0046483	0.675	heterocycle metabolic process
GO:1901576	0.666	organic substance biosynthetic process
GO:0090304	0.666	nucleic acid metabolic process
GO:0010467	0.661	gene expression
GO:0010468	0.652	regulation of gene expression
GO:0009893	0.622	positive regulation of metabolic process
GO:0044249	0.597	cellular biosynthetic process
GO:0009059	0.558	macromolecule biosynthetic process
GO:0044271	0.555	cellular nitrogen compound biosynthetic process
GO:0006351	0.548	DNA-templated transcription
GO:0031326	0.530	regulation of cellular biosynthetic process
GO:0010556	0.529	regulation of macromolecule biosynthetic process
GO:0048522	0.487	positive regulation of cellular process
GO:0006355	0.458	regulation of DNA-templated transcription
GO:0045935	0.444	positive regulation of nucleobase-containing compound metabolic process
GO:0010604	0.372	positive regulation of macromolecule metabolic process
GO:0006366	0.314	transcription by RNA polymerase II

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.999	nucleoplasm
GO:0043232	0.983	intracellular non-membrane-bounded organelle
GO:0032991	0.920	protein-containing complex
GO:0005737	0.905	cytoplasm
GO:0005829	0.865	cytosol
GO:0005730	0.456	nucleolus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]