StarFunc result for job id Q96MR6

User Input

>input (1250 residues)
MSAVVAQTLHVFGLRSHVANNIFYFDEQIIIFPSGNHCVKYNVDQKWQKFIPGSEKSQGM
LALSISPNRRYLAISETVQEKPAITIYELSSIPCRKRKVLNNFDFQVQKFISMAFSPDSK
YLLAQTSPPESNLVYWLWEKQKVMAIVRIDTQNNPVYQVSFSPQDNTQVCVTGNGMFKLL
RFAEGTLKQTSFQRGEPQNYLAHTWVADDKIVVGTDTGKLFLFESGDQRWETSIMVKEPT
NGSKSLDVIQESESLIEFPPVSSPLPSYEQMVAASSHSQMSMPQVFAIAAYSKGFACSAG
PGRVLLFEKMEEKDFYRESREIRIPVDPQSNDPSQSDKQDVLCLCFSPSEETLVASTSKN
QLYSITMSLTEISKGEPAHFEYLMYPLHSAPITGLATCIRKPLIATCSLDRSIRLWNYET
NTLELFKEYQEEAYSISLHPSGHFIVVGFADKLRLMNLLIDDIRSFKEYSVRGCGECSFS
NGGHLFAAVNGNVIHVYTTTSLENISSLKGHTGKIRSIVWNADDSKLISGGTDGAVYEWN
LSTGKRETECVLKSCSYNCVTVSPDAKIIFAVGSDHTLKEIADSLILREISAFDVTYTAI
VISHSGRMMFVGTSVGTIRAMKYPLPLQKEFNEYQAHAGPITKMLLTFDDQFLLTAAEDG
CLFTWKVFDKDGRGIKREREVGFAEEVLVTKTDMEEKAQVMLELKTRVEELKMENEYQLR
LKDMNYSEKIKELTDKFIQEMESLKTKNQVLRTEKEKQDVYHHEHIEDLLDKQSRELQDM
ECCNNQKLLLEYEKYQELQLKSQRMQEEYEKQLRDNDETKSQALEELTEFYEAKLQEKTT
LLEEAQEDVRQQLREFEETKKQIEEDEDREIQDIKTKYEKKLRDEKESNLRLKGETGIMR
KKFSSLQKEIEERTNDIETLKGEQMKLQGVIKSLEKDIQGLKREIQERDETIQDKEKRIY
DLKKKNQELGKFKFVLDYKIKELKKQIEPRENEIRVMKEQIQEMEAELENFHKQNTQLEL
NITELWQKLRATDQEMRRERQKERDLEALVKRFKTDLHNCVAYIQEPRLLKEKVRGLFEK
YVQRADMVEIAGLNTDLQQEYTRQREHLERNLATLKKKVVKEGELHRTDYVRIMQENVSL
IKEINELRRELKFTRSQVYDLEAALKLTKKVRPQEVSETEPSRDMLSTAPTARLNEQEET
GRIIEMQRLEIQRLRDQIQEQEQVTGFHTLAGVRLPSLSNSEVDLEVKTN

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q57UW5	0.536	0.555	3.022E-79	1204	0.287	0.298	Q57UW5.pdb.gz	Q57UW5_TRYB2 Small ribosomal subunit protein RACK1 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb08.4A8.570 PE=4 SV=1
2	AFDB:Q5U0T8	0.520	0.554	1.093E-75	1171	0.256	0.273	Q5U0T8.pdb.gz	Q5U0T8_DROME AT13664p OS=Drosophila melanogaster OX=7227 GN=tous PE=2 SV=1
3	AFDB:Q586S4	0.536	0.502	5.743E-75	1340	0.272	0.254	Q586S4.pdb.gz	Q586S4_TRYB2 Small ribosomal subunit protein RACK1 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=30M24.175 PE=4 SV=1
4	AFDB:Q5TDG3	0.386	0.496	8.138E-34	943	0.082	0.109	Q5TDG3.pdb.gz	Q5TDG3_HUMAN WD repeat domain 3, isoform CRA_b OS=Homo sapiens OX=9606 GN=WDR3 PE=2 SV=1
5	PDB:7rroe	0.413	0.797	1.459E-33	610	0.087	0.179	7rroe.pdb.gz	De novo identification of mammalian ciliary motility proteins using cryo-EM.
6	AFDB:Q9LVF2	0.388	0.494	1.111E-32	955	0.077	0.101	Q9LVF2.pdb.gz	Q9LVF2_ARATH Transducin family protein / WD-40 repeat family protein OS=Arabidopsis thaliana OX=3702 GN=At3g21540 PE=1 SV=1
7	AFDB:P87177	0.386	0.507	3.942E-31	922	0.069	0.093	P87177.pdb.gz	YB1C_SCHPO Uncharacterized WD repeat-containing protein C3D6.12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC3D6.12 PE=1 SV=1
8	AFDB:Q9LFE2	0.326	0.433	1.694E-30	876	0.082	0.116	Q9LFE2.pdb.gz	TOZ_ARATH Protein TORMOZ EMBRYO DEFECTIVE OS=Arabidopsis thaliana OX=3702 GN=TOZ PE=1 SV=1
9	AFDB:O62471	0.225	0.182	2.071E-30	1592	0.072	0.057	O62471.pdb.gz	QUI1_CAEEL Protein qui-1 OS=Caenorhabditis elegans OX=6239 GN=qui-1 PE=1 SV=2
10	PDB:7ajuUL	0.371	0.559	3.194E-30	779	0.074	0.118	7ajuUL.pdb.gz	Structure of the Maturing 90S Pre-ribosome in Association with the RNA Exosome.
11	AFDB:Q12220	0.379	0.487	6.580E-30	943	0.076	0.101	Q12220.pdb.gz	UTP12_YEAST U3 small nucleolar RNA-associated protein 12 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DIP2 PE=1 SV=1
12	PDB:7mqaLQ	0.386	0.555	6.788E-30	830	0.074	0.112	7mqaLQ.pdb.gz	Nucleolar maturation of the human small subunit processome.
13	PDB:7mqaLO	0.361	0.528	5.661E-28	819	0.086	0.131	7mqaLO.pdb.gz	Nucleolar maturation of the human small subunit processome.
14	AFDB:F1RAC4	0.378	0.489	6.710E-28	937	0.077	0.102	F1RAC4.pdb.gz
15	PDB:7mq8LO	0.363	0.514	9.841E-28	848	0.084	0.124	7mq8LO.pdb.gz	Nucleolar maturation of the human small subunit processome.
16	PDB:7d5sB2	0.371	0.520	2.974E-27	851	0.074	0.109	7d5sB2.pdb.gz	Cryo-EM structure of 90S preribosome with inactive Utp24 (state A2)
17	PDB:1nr0A	0.395	0.747	3.127E-27	610	0.062	0.126	1nr0A.pdb.gz
18	PDB:7mq8LR	0.317	0.460	4.021E-27	773	0.060	0.097	7mq8LR.pdb.gz	Nucleolar maturation of the human small subunit processome.
19	PDB:7mq8LT	0.360	0.491	5.489E-26	869	0.066	0.096	7mq8LT.pdb.gz	Nucleolar maturation of the human small subunit processome.
20	PDB:6lqsB1	0.372	0.547	6.070E-26	806	0.076	0.118	6lqsB1.pdb.gz	Cryo-EM structure of 90 S small ribosomal subunit precursors in transition states.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q57UW5	2.95e-175	553	1204	0.291	0.302	Q57UW5_TRYB2 Small ribosomal subunit protein RACK1 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb08.4A8.570 PE=4 SV=1
2	Q586S4	6.45e-146	478	1340	0.271	0.253	Q586S4_TRYB2 Small ribosomal subunit protein RACK1 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=30M24.175 PE=4 SV=1
3	Q9W235	1.04e-142	465	1171	0.262	0.279	Q9W235_DROME FI01301p OS=Drosophila melanogaster OX=7227 GN=tous PE=2 SV=1
4	Q8IHA3	1.24e-142	464	1171	0.262	0.279	Q8IHA3_DROME AT22944p OS=Drosophila melanogaster OX=7227 GN=tous PE=2 SV=1
5	Q5U0T8	1.60e-142	464	1171	0.262	0.279	Q5U0T8_DROME AT13664p OS=Drosophila melanogaster OX=7227 GN=tous PE=2 SV=1
6	Q95SP7	2.97e-133	436	1045	0.237	0.283	Q95SP7_DROME GH09832p OS=Drosophila melanogaster OX=7227 GN=tous PE=2 SV=1
7	Q8IHF3	9.78e-79	276	669	0.152	0.284	Q8IHF3_DROME AT07759p (Fragment) OS=Drosophila melanogaster OX=7227 GN=tous PE=2 SV=1
8	Q3UMY5	9.88e-19	95.1	988	0.114	0.145	EMAL4_MOUSE Echinoderm microtubule-associated protein-like 4 OS=Mus musculus OX=10090 GN=Eml4 PE=1 SV=1
9	E9Q5M6	1.79e-18	94.4	1843	0.090	0.061	CFA44_MOUSE Cilia- and flagella-associated protein 44 OS=Mus musculus OX=10090 GN=Cfap44 PE=2 SV=1
10	Q96MT7	3.40e-17	90.5	1854	0.091	0.061	CFA44_HUMAN Cilia- and flagella-associated protein 44 OS=Homo sapiens OX=9606 GN=CFAP44 PE=1 SV=2
11	O95834	1.19e-15	84.3	649	0.110	0.211	EMAL2_HUMAN Echinoderm microtubule-associated protein-like 2 OS=Homo sapiens OX=9606 GN=EML2 PE=1 SV=1
12	Q6P6T4	1.28e-15	84.3	649	0.113	0.217	EMAL2_RAT Echinoderm microtubule-associated protein-like 2 OS=Rattus norvegicus OX=10116 GN=Eml2 PE=1 SV=1
13	Q9HC35	1.80e-14	81.3	981	0.096	0.122	EMAL4_HUMAN Echinoderm microtubule-associated protein-like 4 OS=Homo sapiens OX=9606 GN=EML4 PE=1 SV=3
14	E7EXY5	1.87e-14	80.9	813	0.110	0.169	E7EXY5_DANRE EMAP-like 1 OS=Danio rerio OX=7955 GN=wu:fj01a06 PE=3 SV=1
15	A0A2R8RMY7	1.88e-14	80.9	817	0.110	0.168	A0A2R8RMY7_DANRE EMAP-like 1 OS=Danio rerio OX=7955 GN=wu:fj01a06 PE=3 SV=1
16	B5MBZ0	1.89e-14	80.9	992	0.096	0.121	B5MBZ0_HUMAN EMAP like 4 OS=Homo sapiens OX=9606 GN=EML4 PE=1 SV=3
17	A8J1V4	2.60e-14	80.9	1764	0.049	0.035	CFA44_CHLRE Cilia- and flagella-associated protein 44 OS=Chlamydomonas reinhardtii OX=3055 GN=CFAP44 PE=1 SV=1
18	Q32P44	2.16e-10	67.8	896	0.058	0.080	EMAL3_HUMAN Echinoderm microtubule-associated protein-like 3 OS=Homo sapiens OX=9606 GN=EML3 PE=1 SV=1
19	Q8JHG6	2.21e-10	67.4	650	0.041	0.078	Q8JHG6_DANRE KIAA0007-like protein OS=Danio rerio OX=7955 GN=kiaa0007l PE=1 SV=1
20	P38129	8.51e-10	65.9	798	0.038	0.060	TAF5_YEAST Transcription initiation factor TFIID subunit 5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TAF5 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12894 ANAPC4_WD40	0.00092	30.8	Anaphase-promoting complex subunit 4 WD40 domain
2	PF08614 ATG16	0.94	21.2	Autophagy protein 16 (ATG16)
3	PF04728 LPP	3.9e+02	12.7	Lipoprotein leucine-zipper
4	PF13360 PQQ_2	2.1e+02	12.9	PQQ-like domain
5	PF13570 PQQ_3	4.5e+02	12.8	PQQ-like domain
6	PF00400 WD40	3.7e-15	67.2	WD domain, G-beta repeat
7	PF17005 WD40_like	36	15.1	WD40-like domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9597.XP_008963608.1

Rank	PPI partner	STRING score	Description
1	9597.XP_008953067.1	0.615	HYDIN, axonemal central pair apparatus protein
2	9597.XP_003827259.2	0.575	Cilia and flagella associated protein 53
3	9597.XP_003832478.1	0.542	Serine dehydratase-like
4	9597.XP_008973109.1	0.541	Enkurin, TRPC channel interacting protein
5	9597.XP_003815185.1	0.540	Clusterin associated protein 1
6	9597.XP_008958776.1	0.504	Transmembrane protein 56

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.979	cellular process
GO:0032501	0.949	multicellular organismal process
GO:0007017	0.909	microtubule-based process
GO:0060271	0.886	cilium assembly
GO:0007018	0.869	microtubule-based movement
GO:0032502	0.832	developmental process
GO:0065007	0.483	biological regulation
GO:0050789	0.457	regulation of biological process
GO:0050794	0.453	regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0005929	1.000	cilium
GO:0005856	0.999	cytoskeleton
GO:0099568	0.535	cytoplasmic region
GO:0097014	0.515	ciliary plasm
GO:0005930	0.471	axoneme
GO:0031514	0.409	motile cilium
GO:0015630	0.353	microtubule cytoskeleton
GO:0043231	0.331	intracellular membrane-bounded organelle
GO:0097729	0.316	9+2 motile cilium
GO:0005815	0.316	microtubule organizing center

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]