StarFunc result for job id Q96MS0

User Input

>input (1386 residues)
MLRYLLKTLLQMNLFADSLAGDISNSSELLLGFNSSLAALNHTLLPPGDPSLNGSRVGPE
DAMPRIVEQPPDLLVSRGEPATLPCRAEGRPRPNIEWYKNGARVATVREDPRAHRLLLPS
GALFFPRIVHGRRARPDEGVYTCVARNYLGAAASRNASLEVAVLRDDFRQSPGNVVVAVG
EPAVLECVPPRGHPEPSVSWRKDGARLKEEEGRITIRGGKLMMSHTLKSDAGMYVCVASN
MAGERESAAAEVMVLERPSFLRRPVNQVVLADAPVTFLCEVKGDPPPRLRWRKEDGELPT
GRYEIRSDHSLWIGHVSAEDEGTYTCVAENSVGRAEASGSLSVHVPPQLVTQPQDQMAAP
GESVAFQCETKGNPPPAIFWQKEGSQVLLFPSQSLQPTGRFSVSPRGQLNITAVQRGDAG
YYVCQAVSVAGSILAKALLEIKGASLDGLPPVILQGPANQTLVLGSSVWLPCRVTGNPQP
SVRWKKDGQWLQGDDLQFKTMANGTLYIANVQEMDMGFYSCVAKSSTGEATWSGWLKMRE
DWGVSPDPPTEPSSPPGAPSQPVVTEITKNSITLTWKPNPQTGAAVTSYVIEAFSPAAGN
TWRTVADGVQLETHTVSGLQPNTIYLFLVRAVGAWGLSEPSPVSEPVRTQDSSPSRPVED
PWRGQQGLAEVAVRLQEPIVLGPRTLQVSWTVDGPVQLVQGFRVSWRVAGPEGGSWTMLD
LQSPSQQSTVLRGLPPGTQIQIKVQAQGQEGLGAESLSVTRSIPEEAPSGPPQGVAVALG
GDGNSSITVSWEPPLPSQQNGVITEYQIWCLGNESRFHLNRSAAGWARSAMLRGLVPGLL
YRTLVAAATSAGVGVPSAPVLVQLPSPPDLEPGLEVGAGLAVRLARVLREPAFLAGSGAA
CGALLLGLCAALYWRRKQRKELSHYTASFAYTPAVSFPHSEGLSGASSRPPMGLGPAPYS
WLADSWPHPSRSPSAQEPRGSCCPSNPDPDDRYYNEAGISLYLAQTARGTAAPGEGPVYS
TIDPAGEELQTFHGGFPQHPSGDLGPWSQYAPPEWSQGDSGAKGGKVKLLGKPVQMPSLN
WPEALPPPPPSCELSCLEGPEEELEGSSEPEEWCPPMPERSHLTEPSSSGGCLVTPSRRE
TPSPTPSYGQQSTATLTPSPPDPPQPPTDMPHLHQMPRRVPLGPSSPLSVSQPMLGIREA
RPAGLGAGPAASPHLSPSPAPSTASSAPGRTWQGNGEMTPPLQGPRARFRKKPKALPYRR
ENSPGDLPPPPLPPPEEEASWALELRAAGSMSSLERERSGERKAVQAVPLAAQRVLHPDE
EAWLPYSRPSFLSRGQGTSTCSTAGSNSSRGSSSSRGSRGPGRSRSRSQSRSQSQRPGQK
RREEPR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A0G2JZA1	0.440	0.409	0.000	1512	0.444	0.407	A0A0G2JZA1.pdb.gz	A0A0G2JZA1_RAT Roundabout guidance receptor 2 OS=Rattus norvegicus OX=10116 GN=Robo2 PE=4 SV=2
2	AFDB:A0A2R8QRK0	0.513	0.502	0.000	1420	0.537	0.524	A0A2R8QRK0.pdb.gz	A0A2R8QRK0_DANRE Roundabout homolog 3 isoform X3 OS=Danio rerio OX=7955 GN=cb503 PE=1 SV=1
3	AFDB:A4JYH1	0.469	0.703	0.000	862	0.335	0.538	A4JYH1.pdb.gz
4	AFDB:F1R2D2	0.483	0.406	0.000	1687	0.413	0.339	F1R2D2.pdb.gz
5	AFDB:O55005	0.498	0.426	0.000	1651	0.400	0.336	O55005.pdb.gz	ROBO1_RAT Roundabout homolog 1 OS=Rattus norvegicus OX=10116 GN=Robo1 PE=1 SV=1
6	AFDB:Q96MS0	1.000	1.000	0.000	1386	1.000	1.000	Q96MS0.pdb.gz	ROBO3_HUMAN Roundabout homolog 3 OS=Homo sapiens OX=9606 GN=ROBO3 PE=1 SV=2
7	AFDB:Q9Z2I4	0.447	0.453	0.000	1366	0.803	0.815	Q9Z2I4.pdb.gz	ROBO3_MOUSE Roundabout homolog 3 OS=Mus musculus OX=10090 GN=Robo3 PE=1 SV=2
8	AFDB:Q9W213	0.364	0.362	4.403E-95	1395	0.281	0.279	Q9W213.pdb.gz	Q9W213_DROME Roundabout 1, isoform A OS=Drosophila melanogaster OX=7227 GN=robo1 PE=1 SV=3
9	AFDB:Q4VA61	0.170	0.122	2.121E-54	2053	0.207	0.140	Q4VA61.pdb.gz	DSCL1_MOUSE Cell adhesion molecule DSCAML1 OS=Mus musculus OX=10090 GN=Dscaml1 PE=1 SV=2
10	AFDB:D3ZB51	0.171	0.176	1.840E-48	1328	0.201	0.210	D3ZB51.pdb.gz	TUTLB_RAT Protein turtle homolog B OS=Rattus norvegicus OX=10116 GN=Igsf9b PE=1 SV=1
11	PDB:5oj2B	0.112	0.201	3.040E-25	692	0.097	0.195	5oj2B.pdb.gz
12	PDB:1e07A	0.168	0.282	3.228E-21	642	0.087	0.187	1e07A.pdb.gz
13	PDB:6dldD	0.113	0.525	9.346E-15	269	0.045	0.234	6dldD.pdb.gz
14	PDB:7sqcO0	0.119	0.138	2.843E-14	1140	0.086	0.104	7sqcO0.pdb.gz	Ciliary central apparatus structure reveals mechanisms of microtubule patterning.
15	PDB:7q1yA	0.077	0.077	3.316E-13	1374	0.069	0.069	7q1yA.pdb.gz
16	PDB:4ziqA	0.076	0.074	6.962E-13	1450	0.075	0.072	4ziqA.pdb.gz
17	PDB:7vonA	0.073	0.073	7.292E-13	1399	0.073	0.072	7vonA.pdb.gz
18	PDB:6pxvA	0.124	0.202	1.009E-12	823	0.041	0.069	6pxvA.pdb.gz
19	PDB:6dlfA	0.134	0.624	1.531E-12	236	0.040	0.233	6dlfA.pdb.gz
20	PDB:8dtlA	0.120	0.215	1.843E-12	741	0.043	0.081	8dtlA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A024B7I3	975	1206	0.353	0.405	A0A024B7I3_CHICK Roundabout-like protein 2 OS=Gallus gallus OX=9031 GN=ROBO2 PE=2 SV=1
2	A0A087WZ85	854	1525	0.323	0.294	A0A087WZ85_HUMAN Roundabout guidance receptor 1 OS=Homo sapiens OX=9606 GN=ROBO1 PE=1 SV=1
3	A0A0A0MSX4	863	1531	0.325	0.294	A0A0A0MSX4_HUMAN Roundabout guidance receptor 1 OS=Homo sapiens OX=9606 GN=ROBO1 PE=1 SV=1
4	A0A0G2JZA1	984	1472	0.358	0.337	A0A0G2JZA1_RAT Roundabout guidance receptor 2 OS=Rattus norvegicus OX=10116 GN=Robo2 PE=4 SV=2
5	A0A1W2Q6F3	986	1512	0.358	0.328	A0A1W2Q6F3_RAT Roundabout guidance receptor 2 OS=Rattus norvegicus OX=10116 GN=Robo2 PE=4 SV=2
6	A0A2R8QRK0	1303	1420	0.532	0.519	A0A2R8QRK0_DANRE Roundabout homolog 3 isoform X3 OS=Danio rerio OX=7955 GN=cb503 PE=1 SV=1
7	A0A8I6A1P7	986	1377	0.357	0.359	A0A8I6A1P7_RAT Roundabout guidance receptor 2 OS=Rattus norvegicus OX=10116 GN=Robo2 PE=4 SV=1
8	A0A8I6AKD6	983	1381	0.358	0.359	A0A8I6AKD6_RAT Roundabout guidance receptor 2 OS=Rattus norvegicus OX=10116 GN=Robo2 PE=4 SV=1
9	A8DZ85	1261	1389	0.514	0.513	A8DZ85_DANRE Roundabout homolog 3 OS=Danio rerio OX=7955 GN=cb503 PE=1 SV=1
10	D3Z4M6	2221	1402	0.834	0.825	D3Z4M6_MOUSE Roundabout guidance receptor 3 OS=Mus musculus OX=10090 GN=Robo3 PE=1 SV=1
11	F1M950	985	1533	0.358	0.324	F1M950_RAT Roundabout guidance receptor 2 OS=Rattus norvegicus OX=10116 GN=Robo2 PE=4 SV=4
12	F1QFK4	1303	1419	0.531	0.519	F1QFK4_DANRE Roundabout homolog 3 isoform 1 OS=Danio rerio OX=7955 GN=cb503 PE=1 SV=1
13	O55005	948	1651	0.355	0.298	ROBO1_RAT Roundabout homolog 1 OS=Rattus norvegicus OX=10116 GN=Robo1 PE=1 SV=1
14	O89026	951	1612	0.355	0.305	ROBO1_MOUSE Roundabout homolog 1 OS=Mus musculus OX=10090 GN=Robo1 PE=1 SV=1
15	Q2M1J3	950	1607	0.356	0.307	Q2M1J3_HUMAN ROBO1 protein OS=Homo sapiens OX=9606 GN=ROBO1 PE=1 SV=1
16	Q7TPD3	979	1470	0.356	0.335	ROBO2_MOUSE Roundabout homolog 2 OS=Mus musculus OX=10090 GN=Robo2 PE=1 SV=2
17	Q8UVD7	946	1614	0.356	0.305	Q8UVD7_XENLA Roundabout guidance receptor 1 L homeolog precursor OS=Xenopus laevis OX=8355 GN=robo1.L PE=2 SV=1
18	Q90Z70	1001	1513	0.373	0.342	Q90Z70_DANRE Robo2 OS=Danio rerio OX=7955 GN=sb:eu937 PE=2 SV=1
19	Q96MS0	2770	1386	1.000	1.000	ROBO3_HUMAN Roundabout homolog 3 OS=Homo sapiens OX=9606 GN=ROBO3 PE=1 SV=2
20	Q9HCK4	990	1378	0.359	0.361	ROBO2_HUMAN Roundabout homolog 2 OS=Homo sapiens OX=9606 GN=ROBO2 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF08205 C2-set_2	2.3e-11	54.9	CD80-like C2-set immunoglobulin domain
2	PF00041 fn3	8.1e-28	107.9	Fibronectin type III domain
3	PF07679 I-set	4.3e-79	272.0	Immunoglobulin I-set domain
4	PF00047 ig	2.4e-49	176.7	Immunoglobulin domain
5	PF13895 Ig_2	4.3e-45	163.2	Immunoglobulin domain
6	PF13927 Ig_3	6.2e-73	252.7	Immunoglobulin domain
7	PF16680 Ig_4	0.02	26.8	T-cell surface glycoprotein CD3 delta chain
8	PF16681 Ig_5	7.7e-07	40.8	Ig-like domain on T-cell surface glycoprotein CD3 epsilon chain
9	PF18452 Ig_6	0.02	26.2	Immunoglobulin domain
10	PF17736 Ig_C17orf99	0.00016	32.9	C17orf99 Ig domain
11	PF16656 Pur_ac_phosph_N	0.0015	30.5	Purple acid Phosphatase, N-terminal domain
12	PF07686 V-set	3.6e-26	102.9	Immunoglobulin V-set domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000380903

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000416341	0.997	Protein kinase C-binding protein NELL2
2	9606.ENSP00000332164	0.979	Slit homolog 3 protein
3	9606.ENSP00000173229	0.969	Netrin-1
4	9606.ENSP00000266058	0.947	Slit homolog 1 protein
5	9606.ENSP00000422591	0.928	Slit homolog 2 protein
6	9606.ENSP00000257552	0.925	RNA-binding protein Musashi homolog 1
7	9606.ENSP00000362680	0.913	Proto-oncogene tyrosine-protein kinase Src
8	9606.ENSP00000304697	0.908	Polyubiquitin-B
9	9606.ENSP00000441543	0.908	Polyubiquitin-C
10	9606.ENSP00000272317	0.900	Ubiquitin-40S ribosomal protein S27a
11	9606.ENSP00000388107	0.900	Ubiquitin-60S ribosomal protein L40
12	9606.ENSP00000298925	0.883	Protein kinase C-binding protein NELL1
13	9606.ENSP00000389140	0.875	Netrin receptor DCC
14	9606.ENSP00000420321	0.815	Roundabout homolog 1
15	9606.ENSP00000378207	0.808	A-kinase anchor protein 5
16	9606.ENSP00000381693	0.803	Zinc finger SWIM-type containing 8
17	9606.ENSP00000386741	0.776	N-chimaerin
18	9606.ENSP00000442600	0.755	Dystroglycan
19	9606.ENSP00000264012	0.753	Cadherin-3
20	9606.ENSP00000343246	0.725	Homeobox protein Hox-A1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.983	cellular process
GO:0032502	0.980	developmental process
GO:0050896	0.976	response to stimulus
GO:0048856	0.968	anatomical structure development
GO:0032501	0.955	multicellular organismal process
GO:0007275	0.946	multicellular organism development
GO:0048731	0.909	system development
GO:0016043	0.895	cellular component organization
GO:0042221	0.876	response to chemical
GO:0007411	0.855	axon guidance
GO:0008037	0.818	cell recognition
GO:0065007	0.779	biological regulation
GO:0050789	0.701	regulation of biological process
GO:0050794	0.667	regulation of cellular process
GO:0008038	0.647	neuron recognition
GO:0016198	0.513	axon choice point recognition
GO:0016477	0.357	cell migration
GO:0001764	0.322	neuron migration
GO:0051716	0.308	cellular response to stimulus
GO:0048518	0.307	positive regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.999	plasma membrane
GO:0120025	0.596	plasma membrane bounded cell projection
GO:0043005	0.353	neuron projection
GO:0005829	0.343	cytosol
GO:0043231	0.313	intracellular membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]