StarFunc result for job id Q96MS3

User Input

>input (346 residues)
MRLLFLAVLRPHTGNAVTAQRVRAHLEAAGHVCVLKDAFDFESRSEIANLILAENCEAAL
ALHLYRGGRLLQGHRIPFGVIFGGTDVNEDANQAEKNTVMGRVLEEARFAVAFTESMKEM
AQAQWPHAKGKVYVQSQGIATTPNAAFNWNTFLQRSEINQSADNLHIFLLICGLRQVKDP
LYLVDAFSAWHQEEPNVHLVIVGPEVDPVFTREVKAKVKRAAGVRLIGEMPQEDLHAVVK
NCFAVVNSSVSEGMSAAILEAMDLEVPVLARNIPGNAAVVKHEVTGLLFSNPQEFVHLAK
RLVSDPALEKEIVVNGREYVRMYHSWQVERDTYQQLIRKLEGSTED

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:F5H088	0.947	0.933	9.425E-61	351	0.936	0.923	F5H088.pdb.gz	F5H088_HUMAN Glycosyltransferase 1 domain containing 1 OS=Homo sapiens OX=9606 GN=GLT1D1 PE=1 SV=1
2	AFDB:Q93P60	0.719	0.637	9.137E-19	398	0.165	0.143	Q93P60.pdb.gz	AMGDS_ACHLA Alpha-monoglucosyldiacylglycerol synthase OS=Acholeplasma laidlawii OX=2148 GN=mgs PE=1 SV=1
3	AFDB:Q9I1N0	0.710	0.673	7.285E-17	367	0.176	0.166	Q9I1N0.pdb.gz	Q9I1N0_PSEAE PslI OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=pslI PE=4 SV=1
4	AFDB:P9WMZ1	0.772	0.698	2.306E-16	387	0.214	0.191	P9WMZ1.pdb.gz	GLGM_MYCTU Alpha-maltose-1-phosphate synthase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=glgM PE=1 SV=1
5	AFDB:Q94BX4	0.758	0.604	2.443E-16	447	0.173	0.134	Q94BX4.pdb.gz	PIGA_ARATH Phosphatidylinositol N-acetylglucosaminyltransferase subunit A OS=Arabidopsis thaliana OX=3702 GN=PIGA PE=2 SV=1
6	AFDB:Q9H553	0.687	0.590	3.656E-16	416	0.182	0.151	Q9H553.pdb.gz	ALG2_HUMAN Alpha-1,3/1,6-mannosyltransferase ALG2 OS=Homo sapiens OX=9606 GN=ALG2 PE=1 SV=1
7	AFDB:Q7KWM5	0.680	0.576	4.877E-16	420	0.171	0.140	Q7KWM5.pdb.gz	ALG2_DICDI Alpha-1,3/1,6-mannosyltransferase ALG2 OS=Dictyostelium discoideum OX=44689 GN=alg2 PE=3 SV=1
8	AFDB:X5KCU9	0.647	0.523	5.797E-16	444	0.165	0.128	X5KCU9.pdb.gz	X5KCU9_STRAG 1,2-diacylglycerol 3-glucosyltransferase OS=Streptococcus agalactiae OX=1311 GN=mgtA PE=4 SV=1
9	AFDB:Q585S5	0.718	0.562	6.505E-16	455	0.139	0.105	Q585S5.pdb.gz	Q585S5_TRYB2 phosphatidylinositol N-acetylglucosaminyltransferase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=27H14.50 PE=4 SV=1
10	AFDB:P0CF99	0.762	0.700	1.544E-15	381	0.147	0.134	P0CF99.pdb.gz	PIMC_MYCTO GDP-mannose-dependent alpha-(1-6)-phosphatidylinositol dimannoside mannosyltransferase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=pimC PE=1 SV=1
11	PDB:3s27H	0.668	0.314	1.065E-12	797	0.162	0.070	3s27H.pdb.gz	The Structure of Sucrose Synthase-1 from Arabidopsis thaliana and Its Functional Implications.
12	PDB:3okaA	0.690	0.640	3.004E-12	378	0.153	0.140	3okaA.pdb.gz	Acceptor substrate discrimination in phosphatidyl-myo-inositol mannoside synthesis: structural and mutational analysis of mannosyltransferase Corynebacterium glutamicum PimB'.
13	PDB:4pqgA	0.628	0.447	5.046E-12	506	0.136	0.093	4pqgA.pdb.gz	Structure of a Novel O-Linked N-Acetyl-d-glucosamine (O-GlcNAc) Transferase, GtfA, Reveals Insights into the Glycosylation of Pneumococcal Serine-rich Repeat Adhesins.
14	PDB:5e9uA	0.609	0.435	7.130E-12	503	0.136	0.093	5e9uA.pdb.gz	Mechanism of a cytosolic O-glycosyltransferase essential for the synthesis of a bacterial adhesion protein.
15	PDB:3guhA	0.677	0.517	8.001E-12	477	0.179	0.130	3guhA.pdb.gz	The Crystal Structures of the Open and Catalytically Competent Closed Conformation of Escherichia coli Glycogen Synthase.
16	PDB:5hvoA	0.673	0.528	2.011E-11	459	0.159	0.120	5hvoA.pdb.gz	Structural and In Vivo Studies on Trehalose-6-Phosphate Synthase from Pathogenic Fungi Provide Insights into Its Catalytic Mechanism, Biological Necessity, and Potential for Novel Antifungal Drug Design.
17	PDB:2wtxD	0.715	0.559	3.791E-11	457	0.142	0.107	2wtxD.pdb.gz	Mechanistic Insight Into Enzymatic Glycosyl Transfer with Retention of Configuration Through Analysis of Glycomimetic Inhibitors.
18	PDB:5hvmB	0.672	0.530	5.674E-11	452	0.179	0.137	5hvmB.pdb.gz	Structural and In Vivo Studies on Trehalose-6-Phosphate Synthase from Pathogenic Fungi Provide Insights into Its Catalytic Mechanism, Biological Necessity, and Potential for Novel Antifungal Drug Design.
19	PDB:1f6dA	0.658	0.614	1.903E-10	376	0.156	0.144	1f6dA.pdb.gz	The structure of UDP-N-acetylglucosamine 2-epimerase reveals homology to phosphoglycosyl transferases.
20	PDB:2iv7A	0.745	0.701	2.262E-10	370	0.142	0.132	2iv7A.pdb.gz	Insights Into the Synthesis of Lipopolysaccharide and Antibiotics Through the Structures of Two Retaining Glycosyltransferases from Family Gt4

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	F5H088	0.0	660	351	0.934	0.920	F5H088_HUMAN Glycosyltransferase 1 domain containing 1 OS=Homo sapiens OX=9606 GN=GLT1D1 PE=1 SV=1
2	Q96MS3	0.0	714	346	1.000	1.000	GL1D1_HUMAN Glycosyltransferase 1 domain-containing protein 1 OS=Homo sapiens OX=9606 GN=GLT1D1 PE=2 SV=2
3	F1QPS1	8.10e-05	46.6	455	0.087	0.066	F1QPS1_DANRE Alpha-1,3/1,6-mannosyltransferase ALG2 OS=Danio rerio OX=7955 GN=im:7145131 PE=1 SV=1
4	Q9H553	2.19e-04	45.1	416	0.107	0.089	ALG2_HUMAN Alpha-1,3/1,6-mannosyltransferase ALG2 OS=Homo sapiens OX=9606 GN=ALG2 PE=1 SV=1
5	Q3S2Y2	4.88e-04	44.3	506	0.101	0.069	GTFA_STRAG UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase GtfA subunit OS=Streptococcus agalactiae OX=1311 GN=gtfA PE=1 SV=1
6	Q94BX4	0.002	42.4	447	0.153	0.119	PIGA_ARATH Phosphatidylinositol N-acetylglucosaminyltransferase subunit A OS=Arabidopsis thaliana OX=3702 GN=PIGA PE=2 SV=1
7	Q8IJ83	0.006	40.8	461	0.066	0.050	Q8IJ83_PLAF7 Phosphatidylinositol N-acetylglucosaminyltransferase subunit A, putative OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1032400 PE=4 SV=2
8	Q54Q41	0.012	40.0	1065	0.066	0.022	Q54Q41_DICDI Glycosyltransferase OS=Dictyostelium discoideum OX=44689 GN=pgtC PE=4 SV=1
9	Q7KWM5	0.012	39.7	420	0.133	0.110	ALG2_DICDI Alpha-1,3/1,6-mannosyltransferase ALG2 OS=Dictyostelium discoideum OX=44689 GN=alg2 PE=3 SV=1
10	Q93P60	0.012	39.7	398	0.084	0.073	AMGDS_ACHLA Alpha-monoglucosyldiacylglycerol synthase OS=Acholeplasma laidlawii OX=2148 GN=mgs PE=1 SV=1
11	A0A0H2URG7	0.020	39.3	503	0.127	0.087	GTFA_STRPN UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase GtfA subunit OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=gtfA PE=1 SV=1
12	Q65CC7	0.034	38.1	386	0.118	0.106	KANE_STRKN Alpha-D-kanosaminyltransferase OS=Streptomyces kanamyceticus OX=1967 GN=kanE PE=1 SV=1
13	P37287	0.040	38.1	484	0.061	0.043	PIGA_HUMAN Phosphatidylinositol N-acetylglucosaminyltransferase subunit A OS=Homo sapiens OX=9606 GN=PIGA PE=1 SV=1
14	Q65CC1	0.083	37.0	387	0.084	0.075	KANF_STRKN 2-deoxystreptamine glucosyltransferase OS=Streptomyces kanamyceticus OX=1967 GN=kanF PE=1 SV=1
15	Q54GL6	0.15	36.6	1338	0.098	0.025	Q54GL6_DICDI Glycosyltransferase OS=Dictyostelium discoideum OX=44689 GN=pgtB PE=4 SV=1
16	Q9HTB9	0.16	36.2	375	0.052	0.048	Q9HTB9_PSEAE Glycosyltransferase WbpY OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=wbpY PE=4 SV=1
17	Q9HTB4	0.37	35.0	433	0.081	0.065	Q9HTB4_PSEAE Glycosyltransferase OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=PA5456 PE=4 SV=1
18	G3XCU3	0.60	34.3	460	0.090	0.067	G3XCU3_PSEAE Glycosyltransferase WbpX OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=wbpX PE=4 SV=1
19	O84908	0.60	34.3	460	0.090	0.067	O84908_PSEAI Glycosyltransferase Gtf1 OS=Pseudomonas aeruginosa OX=287 GN=wbpX PE=4 SV=1
20	Q9LSB5	0.63	34.7	697	0.069	0.034	Q9LSB5_ARATH AT3g15940/MVC8_7 OS=Arabidopsis thaliana OX=3702 GN=1g52420 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF09413 DUF2007	1e+02	14.5	Putative prokaryotic signal transducing protein
2	PF10971 DUF2773	1.5e+02	14.0	Protein of unknown function (DUF2773)
3	PF02350 Epimerase_2	46	14.3	UDP-N-acetylglucosamine 2-epimerase
4	PF00534 Glycos_transf_1	9.2e-21	85.6	Glycosyl transferases group 1
5	PF13524 Glyco_trans_1_2	0.0011	30.6	Glycosyl transferases group 1
6	PF13692 Glyco_trans_1_4	7.9e-16	70.1	Glycosyl transferases group 1

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9593.ENSGGOP00000014491

Rank	PPI partner	STRING score	Description
1	9593.ENSGGOP00000018707	0.691	acyl-CoA oxidase 3, pristanoyl
2	9593.ENSGGOP00000013395	0.684	Equatorin, sperm acrosome associated
3	9593.ENSGGOP00000014121	0.655	Solute carrier family 15 (oligopeptide transporter), member 4
4	9593.ENSGGOP00000008006	0.611	Mitochondrial amidoxime reducing component 1
5	9593.ENSGGOP00000000291	0.607	Multiple EGF-like-domains 11

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0016757	1.000	glycosyltransferase activity
GO:0005515	0.999	protein binding
GO:0016758	0.991	hexosyltransferase activity
GO:0008194	0.942	UDP-glycosyltransferase activity
GO:0046527	0.553	glucosyltransferase activity
GO:0035251	0.411	UDP-glucosyltransferase activity
GO:1901363	0.305	heterocyclic compound binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.999	cellular process
GO:0071704	0.992	organic substance metabolic process
GO:0044238	0.937	primary metabolic process
GO:0044237	0.853	cellular metabolic process
GO:0006807	0.809	nitrogen compound metabolic process
GO:0009058	0.807	biosynthetic process
GO:1901576	0.794	organic substance biosynthetic process
GO:0043170	0.752	macromolecule metabolic process
GO:0044249	0.748	cellular biosynthetic process
GO:0044260	0.512	cellular macromolecule metabolic process
GO:1901137	0.485	carbohydrate derivative biosynthetic process
GO:1901564	0.425	organonitrogen compound metabolic process
GO:0034645	0.326	cellular macromolecule biosynthetic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.998	cytosol
GO:0031982	0.894	vesicle
GO:0005886	0.511	plasma membrane
GO:0012505	0.351	endomembrane system
GO:0043231	0.309	intracellular membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.4.-.-	1.000	Glycosyltransferases.
EC:2.4.1.-	0.991	Hexosyltransferases.

[back to server]