StarFunc result for job id Q96MT7

User Input

>input (1854 residues)
MKEPDDQDTDGEKSVTSKSDGKKSLRSSKSESRSPVQEDNTFLEDDTDETFTKGEGSYLE
EDSDEERLEGSLSSFQYGDLQSTTVPQQTPAPAVEEAEEEVKKKISESFFYDYMELASMP
FVTLDSNIPLDLLTLVHSFGYDCRKRANLQLLDDSIAIYIAGNQLIFLNLKTKEQIYLRS
SSGEGIGVIGVHPHKTYFTVAEKGSFPDIIIYEYPSLRPYRVLRDGTEKGYAYVDFNYSG
NLLASVGSNPDYTLTIWNWKEEQPILRTKAFSQEVFKVTFNPDKEEQLTTSGSGHIKFWE
MAFTFTGLKLQGSLGRFGKTITTDIEGYMELPDGKVLSGSEWGNMLLWEGGLIKVELCRG
TSKSCHNGPINQIMLYEGEVITVGSDGYVRIWDFETIDTADVIDETGLLEIEPINELQVD
KNVNLFSMIKMNETGNNFWLAQDANGAIWKLDLSFSNITQDPECLFSFHSGAIEAVAVSP
LTYLMATTALDCSVRIYDFASKTPLAQMKFKQGGTALVWVPRMVNFTGAQIIVGFEDGVV
RILELYDPKGLTIFAGRKKILDADIQLKQVFKPHTACVTALAYERDGEILATGSKDQTVF
FFEVERDYKPIGYINTPGPVCQLMWSPMSHPESTLLIICENGYILEAPLPTIKQEEDDHD
VVSYEIKDMCIKCFHFSSVKSKILRLIEIEKRERQRELKEKIREERRNKLAAEMGEDGEK
EFQEEEEEKEEEEEEEEPLPEIFIPSTPSPILCGFYSEPGKFWVSLGGYDSGFLYHCEFP
PCDESSDFKEQKDEPIDVRYLADTEDNPIQTITFNINKVMMFCGMKNGAIRVYVLNQNDP
SLTSLVDYWHFNMHDNNYGCIKSIANSFDDRFLVTAGADGNIFVFNIFSEFMLRKDMKAK
VPSPRFGIETEPIPEDIEDPKAYSIENARRKREHDKLMKEVGEIKARKREQIKALRSEFC
NLLEMNEKLPKHMQFKRTDFDVDSQIRAEMHRKTAFKIQQVEKELAWEKEKHELGLMKLK
NRFRDPLESDTIVVHAILSDHKISSYRLVQPSKYSKFKRASQSERKPSKLDRFEKEGPGR
KDSQRDAGGSVTIQEESIIEKGKKFRPKTLSEIIVENQIEKTRKLILKAERAQLKIQQRK
KEWEELYKSKPGDDYEDPKDLQAIKEAQVYMGDFNLKTAPDYKIPEHMRINAAKKEEELG
HLDSLVHGNKRHMNKCILSLRDLKVAVVEEIQCLVQELKNIQSTLHISKHIPIPKIPQIH
PEEVPEKRFQYDEETLLNFKQQQMKSKDEKSPGVEQTGSGGPVGGFLKLSSRKDGDLTTR
DSISRSSKASTFSLDIPKCLEFEKAEPTDVELEIMKRDEIKHVYMQQYLVNRIKELVVTF
DAELRLLRHQKLKLDTQMKLSDLHHVTLFQEILLLKNFEKQENILQERVNSLDKEEQYMQ
WKINETLKEMEEKKNEITKLQEQEKALYAGFQAAIGENNKFANFLMKVLKKKIKRVKKKE
VEGDADEDEESEESSEEESSLESDEDESESEDEVFDDSICPTNCDVALFELALHLREKRL
DIEEALVEEKKIVDNLKKEYDTLSKKVKIVATNLNAAEEALEAYQREKQQRLNELLVVIP
LKLHQIEYVVFGEIPSDLSGTLVFSNHALRRLQERIHELQEENSKQQKLNKEWRERRKQL
IREKREMTKTIHKMEETVRQLMISKFGRVVNLEALQTLSVNTTLEELKIRKLRKELANAK
EMKMWEEKIAQMRWELMMKTKEHTRKLYQMNDLCIEKKKLDSRLNTLQNQQGNAFQGPRE
ADVVAREEVTELIQLQAERISALKEEIALLRRKGSLILPPIQSPREKEIQPADL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:E9Q5M6	0.460	0.463	0.000	1843	0.756	0.760	E9Q5M6.pdb.gz	CFA44_MOUSE Cilia- and flagella-associated protein 44 OS=Mus musculus OX=10090 GN=Cfap44 PE=2 SV=1
2	AFDB:Q96MT7	1.000	1.000	0.000	1854	1.000	1.000	Q96MT7.pdb.gz	CFA44_HUMAN Cilia- and flagella-associated protein 44 OS=Homo sapiens OX=9606 GN=CFAP44 PE=1 SV=2
3	AFDB:Q8NDM7	0.312	0.345	6.129E-57	1665	0.138	0.154	Q8NDM7.pdb.gz	CFA43_HUMAN Cilia- and flagella-associated protein 43 OS=Homo sapiens OX=9606 GN=CFAP43 PE=1 SV=3
4	AFDB:E9Q7R9	0.306	0.335	1.107E-56	1682	0.139	0.153	E9Q7R9.pdb.gz	CFA43_MOUSE Cilia- and flagella-associated protein 43 OS=Mus musculus OX=10090 GN=Cfap43 PE=1 SV=1
5	AFDB:A0A1L8GXY4	0.311	0.351	8.341E-56	1621	0.138	0.157	A0A1L8GXY4.pdb.gz	CFA43_XENLA Cilia- and flagella-associated protein 43 OS=Xenopus laevis OX=8355 GN=cfap43 PE=2 SV=1
6	AFDB:Q05BV3	0.269	0.254	1.480E-37	1969	0.076	0.071	Q05BV3.pdb.gz	EMAL5_HUMAN Echinoderm microtubule-associated protein-like 5 OS=Homo sapiens OX=9606 GN=EML5 PE=2 SV=3
7	AFDB:Q96KV7	0.296	0.313	3.298E-36	1748	0.065	0.069	Q96KV7.pdb.gz	WDR90_HUMAN WD repeat-containing protein 90 OS=Homo sapiens OX=9606 GN=WDR90 PE=1 SV=2
8	AFDB:F1LRR4	0.280	0.330	1.993E-33	1551	0.088	0.106	F1LRR4.pdb.gz	F1LRR4_RAT WD repeat domain 62 OS=Rattus norvegicus OX=10116 GN=Wdr62 PE=1 SV=4
9	AFDB:O43379	0.278	0.333	2.549E-33	1518	0.086	0.105	O43379.pdb.gz	WDR62_HUMAN WD repeat-containing protein 62 OS=Homo sapiens OX=9606 GN=WDR62 PE=1 SV=4
10	AFDB:M9PB01	0.279	0.220	9.639E-33	2397	0.084	0.065	M9PB01.pdb.gz	M9PB01_DROME WD repeat domain 62, isoform G OS=Drosophila melanogaster OX=7227 GN=Wdr62 PE=4 SV=1
11	PDB:7rroe	0.267	0.712	6.872E-26	610	0.060	0.182	7rroe.pdb.gz	De novo identification of mammalian ciliary motility proteins using cryo-EM.
12	PDB:7mqaLQ	0.269	0.560	7.583E-26	830	0.053	0.118	7mqaLQ.pdb.gz	Nucleolar maturation of the human small subunit processome.
13	PDB:7ajuUL	0.267	0.586	1.139E-24	779	0.058	0.139	7ajuUL.pdb.gz	Structure of the Maturing 90S Pre-ribosome in Association with the RNA Exosome.
14	PDB:7mq8LR	0.172	0.307	2.161E-24	773	0.047	0.113	7mq8LR.pdb.gz	Nucleolar maturation of the human small subunit processome.
15	PDB:6lqsB1	0.244	0.488	2.083E-23	806	0.058	0.133	6lqsB1.pdb.gz	Cryo-EM structure of 90 S small ribosomal subunit precursors in transition states.
16	PDB:7d5sB2	0.272	0.549	3.763E-23	851	0.052	0.113	7d5sB2.pdb.gz	Cryo-EM structure of 90S preribosome with inactive Utp24 (state A2)
17	PDB:7mqaLO	0.232	0.461	1.495E-22	819	0.050	0.112	7mqaLO.pdb.gz	Nucleolar maturation of the human small subunit processome.
18	PDB:1nr0A	0.244	0.614	1.733E-22	610	0.044	0.133	1nr0A.pdb.gz
19	PDB:7mq8LO	0.234	0.454	2.110E-22	848	0.052	0.113	7mq8LO.pdb.gz	Nucleolar maturation of the human small subunit processome.
20	PDB:7ajtUA	0.234	0.457	4.003E-22	834	0.057	0.127	7ajtUA.pdb.gz	Structure of the Maturing 90S Pre-ribosome in Association with the RNA Exosome.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	E9Q5M6	0.0	2762	1843	0.759	0.764	CFA44_MOUSE Cilia- and flagella-associated protein 44 OS=Mus musculus OX=10090 GN=Cfap44 PE=2 SV=1
2	Q96MT7	0.0	3819	1854	1.000	1.000	CFA44_HUMAN Cilia- and flagella-associated protein 44 OS=Homo sapiens OX=9606 GN=CFAP44 PE=1 SV=2
3	Q57WH1	1.80e-64	246	1760	0.087	0.092	CFA44_TRYB2 Cilia- and flagella-associated protein 44 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=CFAP44 PE=3 SV=1
4	A8J1V4	6.00e-60	231	1764	0.092	0.096	CFA44_CHLRE Cilia- and flagella-associated protein 44 OS=Chlamydomonas reinhardtii OX=3055 GN=CFAP44 PE=1 SV=1
5	Q05BV3	4.53e-30	133	1969	0.069	0.065	EMAL5_HUMAN Echinoderm microtubule-associated protein-like 5 OS=Homo sapiens OX=9606 GN=EML5 PE=2 SV=3
6	E7EXY5	1.14e-18	95.1	813	0.066	0.150	E7EXY5_DANRE EMAP-like 1 OS=Danio rerio OX=7955 GN=wu:fj01a06 PE=3 SV=1
7	A0A2R8RMY7	1.33e-18	95.1	817	0.060	0.137	A0A2R8RMY7_DANRE EMAP-like 1 OS=Danio rerio OX=7955 GN=wu:fj01a06 PE=3 SV=1
8	Q8NDM7	9.56e-18	92.8	1665	0.057	0.064	CFA43_HUMAN Cilia- and flagella-associated protein 43 OS=Homo sapiens OX=9606 GN=CFAP43 PE=1 SV=3
9	Q3UMY5	1.95e-17	91.7	988	0.072	0.136	EMAL4_MOUSE Echinoderm microtubule-associated protein-like 4 OS=Mus musculus OX=10090 GN=Eml4 PE=1 SV=1
10	B5MBZ0	2.77e-17	90.9	992	0.066	0.124	B5MBZ0_HUMAN EMAP like 4 OS=Homo sapiens OX=9606 GN=EML4 PE=1 SV=3
11	Q9HC35	3.63e-17	90.5	981	0.066	0.125	EMAL4_HUMAN Echinoderm microtubule-associated protein-like 4 OS=Homo sapiens OX=9606 GN=EML4 PE=1 SV=3
12	A0A1L8GXY4	2.46e-16	88.2	1621	0.028	0.031	CFA43_XENLA Cilia- and flagella-associated protein 43 OS=Xenopus laevis OX=8355 GN=cfap43 PE=2 SV=1
13	E9Q7R9	7.68e-16	86.7	1682	0.024	0.026	CFA43_MOUSE Cilia- and flagella-associated protein 43 OS=Mus musculus OX=10090 GN=Cfap43 PE=1 SV=1
14	B4DHB6	4.57e-15	83.6	940	0.023	0.045	B4DHB6_HUMAN cDNA FLJ56982 OS=Homo sapiens OX=9606 PE=1 SV=1
15	A0A0C4DGQ7	2.22e-14	80.1	427	0.046	0.201	A0A0C4DGQ7_HUMAN EMAP like 2 OS=Homo sapiens OX=9606 GN=EML2 PE=1 SV=1
16	Q6P6T4	4.26e-14	80.1	649	0.064	0.183	EMAL2_RAT Echinoderm microtubule-associated protein-like 2 OS=Rattus norvegicus OX=10116 GN=Eml2 PE=1 SV=1
17	Q57UW5	1.09e-13	79.3	1204	0.046	0.071	Q57UW5_TRYB2 Small ribosomal subunit protein RACK1 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb08.4A8.570 PE=4 SV=1
18	Q05BC3	3.33e-13	77.4	814	0.058	0.133	EMAL1_MOUSE Echinoderm microtubule-associated protein-like 1 OS=Mus musculus OX=10090 GN=Eml1 PE=1 SV=1
19	O95834	7.77e-13	75.9	649	0.071	0.203	EMAL2_HUMAN Echinoderm microtubule-associated protein-like 2 OS=Homo sapiens OX=9606 GN=EML2 PE=1 SV=1
20	O00423	1.69e-12	75.1	815	0.057	0.129	EMAL1_HUMAN Echinoderm microtubule-associated protein-like 1 OS=Homo sapiens OX=9606 GN=EML1 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12894 ANAPC4_WD40	0.00032	32.2	Anaphase-promoting complex subunit 4 WD40 domain
2	PF20426 NBCH_WD40	0.007	26.8	Neurobeachin beta propeller domain
3	PF00400 WD40	1.3e-15	68.6	WD domain, G-beta repeat

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000377428

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000373948	0.789	Cilia- and flagella-associated protein 69
2	9606.ENSP00000401514	0.753	Dynein heavy chain 1, axonemal
3	9606.ENSP00000328079	0.667	WD repeat-containing protein 53
4	9606.ENSP00000344403	0.640	Plays a role in spermatogenesis.
5	9606.ENSP00000006526	0.620	WD repeat-containing protein 54
6	9606.ENSP00000351327	0.602	A-kinase anchor protein 4
7	9606.ENSP00000376417	0.596	Required for sperm flagellum axoneme organization and function (By similarity). Involved in axonemal central pair complex assembly and/or stability (By similarity).
8	9606.ENSP00000248098	0.583	Jupiter microtubule associated homolog 2
9	9606.ENSP00000262765	0.570	Glutamine-rich protein 2
10	9606.ENSP00000405708	0.565	Coiled-coil domain-containing protein 39
11	9606.ENSP00000283025	0.552	Tektin-5
12	9606.ENSP00000373278	0.547	Zinc finger CW-type and PWWP domain containing 2
13	9606.ENSP00000348314	0.543	Sperm flagellar protein 2
14	9606.ENSP00000332750	0.517	Zinc finger protein with KRAB and SCAN domains 8
15	9606.ENSP00000293845	0.505	Coiled-coil domain-containing protein 42
16	9606.ENSP00000274673	0.504	Protein FAM217A
17	9606.ENSP00000323928	0.504	Olfactory receptor 8H3
18	9606.ENSP00000353942	0.502	Dynein regulatory complex subunit 7

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0008233	1.000	peptidase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.997	cellular process
GO:0030317	0.987	flagellated sperm motility
GO:0120316	0.976	sperm flagellum assembly
GO:0035082	0.973	axoneme assembly
GO:0007288	0.957	sperm axoneme assembly
GO:0065007	0.353	biological regulation
GO:0050789	0.316	regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043227	0.999	membrane-bounded organelle
GO:0043229	0.999	intracellular organelle
GO:0005929	0.986	cilium
GO:0043232	0.964	intracellular non-membrane-bounded organelle
GO:0005737	0.928	cytoplasm
GO:0005856	0.918	cytoskeleton
GO:0043231	0.869	intracellular membrane-bounded organelle
GO:0005634	0.842	nucleus
GO:0031514	0.820	motile cilium
GO:0097729	0.680	9+2 motile cilium
GO:0005654	0.582	nucleoplasm
GO:0097014	0.381	ciliary plasm
GO:0036126	0.318	sperm flagellum
GO:0005930	0.312	axoneme

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.4.-.-	1.000	Acting on peptide bonds (peptidases).

[back to server]