StarFunc result for job id Q96MU8

User Input

>input (473 residues)
MAPPAARLALLSAAALTLAARPAPSPGLGPECFTANGADYRGTQNWTALQGGKPCLFWNE
TFQHPYNTLKYPNGEGGLGEHNYCRNPDGDVSPWCYVAEHEDGVYWKYCEIPACQMPGNL
GCYKDHGNPPPLTGTSKTSNKLTIQTCISFCRSQRFKFAGMESGYACFCGNNPDYWKYGE
AASTECNSVCFGDHTQPCGGDGRIILFDTLVGACGGNYSAMSSVVYSPDFPDTYATGRVC
YWTIRVPGASHIHFSFPLFDIRDSADMVELLDGYTHRVLARFHGRSRPPLSFNVSLDFVI
LYFFSDRINQAQGFAVLYQAVKEELPQERPAVNQTVAEVITEQANLSVSAARSSKVLYVI
TTSPSHPPQTVPGSNSWAPPMGAGSHRVEGWTVYGLATLLILTVTAIVAKILLHVTFKSH
RVPASGDLRDCHQPGTSGEIWSIFYKPSTSISIFKKKLKGQSQQDDRNPLVSD

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q96MU8	1.000	1.000	1.672E-91	473	1.000	1.000	Q96MU8.pdb.gz	KREM1_HUMAN Kremen protein 1 OS=Homo sapiens OX=9606 GN=KREMEN1 PE=1 SV=3
2	AFDB:Q8K1S7	0.618	0.633	4.287E-48	461	0.357	0.367	Q8K1S7.pdb.gz	KREM2_MOUSE Kremen protein 2 OS=Mus musculus OX=10090 GN=Kremen2 PE=1 SV=1
3	AFDB:Q8NCW0	0.609	0.623	1.659E-47	462	0.364	0.372	Q8NCW0.pdb.gz	KREM2_HUMAN Kremen protein 2 OS=Homo sapiens OX=9606 GN=KREMEN2 PE=2 SV=1
4	AFDB:Q8K480	0.223	0.181	1.500E-6	584	0.076	0.062	Q8K480.pdb.gz	MFRP_MOUSE Membrane frizzled-related protein OS=Mus musculus OX=10090 GN=Mfrp PE=1 SV=1
5	AFDB:Q9BY79	0.222	0.183	5.471E-6	579	0.070	0.057	Q9BY79.pdb.gz	MFRP_HUMAN Membrane frizzled-related protein OS=Homo sapiens OX=9606 GN=MFRP PE=1 SV=1
6	AFDB:G4LU05	0.201	0.118	5.802E-6	822	0.057	0.033	G4LU05.pdb.gz	G4LU05_DROME Neuropilin and tolloid-like, isoform B OS=Drosophila melanogaster OX=7227 GN=Neto PE=2 SV=1
7	PDB:4a5tS	0.151	0.096	1.946E-4	767	0.089	0.055	4a5tS.pdb.gz
8	PDB:4duuA	0.174	0.127	2.189E-4	682	0.135	0.094	4duuA.pdb.gz
9	AFDB:A2Q9N6	0.143	0.089	7.222E-4	844	0.091	0.051	A2Q9N6.pdb.gz	A2Q9N6_ASPNC Kexin kexB-Aspergillus niger OS=Aspergillus niger (strain ATCC MYA-4892 / CBS 513.88 / FGSC A1513) OX=425011 GN=kexB PE=3 SV=1
10	AFDB:Q4WQI8	0.146	0.090	7.222E-4	844	0.078	0.044	Q4WQI8.pdb.gz	Q4WQI8_ASPFU Pheromone processing endoprotease KexB OS=Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293) OX=330879 GN=AFUA_4G12970 PE=3 SV=1
11	AFDB:A0A1D8PEG3	0.127	0.072	1.028E-3	936	0.089	0.045	A0A1D8PEG3.pdb.gz	A0A1D8PEG3_CANAL Kexin OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=KEX2 PE=3 SV=1
12	AFDB:P26016	0.151	0.066	1.379E-3	1269	0.074	0.028	P26016.pdb.gz	FUR11_DROME Furin-like protease 1, isoforms 1/1-X/2 OS=Drosophila melanogaster OX=7227 GN=Fur1 PE=2 SV=2
13	PDB:7b01A	0.171	0.141	3.911E-3	588	0.074	0.060	7b01A.pdb.gz	Crystal structure of ADAMTS13 CUB domains reveals their role in global latency.
14	PDB:3am2A	0.162	0.247	5.566E-3	286	0.030	0.049	3am2A.pdb.gz
15	PDB:5vaeB	0.119	0.282	5.566E-3	134	0.025	0.090	5vaeB.pdb.gz
16	PDB:1js9C	0.149	0.303	6.261E-3	189	0.032	0.079	1js9C.pdb.gz
17	PDB:6djzB	0.122	0.225	1.805E-2	221	0.021	0.045	6djzB.pdb.gz	Structural basis for sigma1receptor ligand recognition.
18	PDB:4n20A	0.108	0.083	2.890E-2	639	0.019	0.014	4n20A.pdb.gz	Protein arginine deiminase 2 binds calcium in an ordered fashion: implications for inhibitor design.
19	PDB:1zvfA	0.116	0.250	3.448E-2	176	0.025	0.068	1zvfA.pdb.gz
20	PDB:2waaA	0.114	0.149	3.448E-2	335	0.038	0.054	2waaA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q96MU8	0.0	988	473	1.000	1.000	KREM1_HUMAN Kremen protein 1 OS=Homo sapiens OX=9606 GN=KREMEN1 PE=1 SV=3
2	Q99N43	0.0	887	473	0.937	0.937	KREM1_MOUSE Kremen protein 1 OS=Mus musculus OX=10090 GN=Kremen1 PE=1 SV=2
3	Q8NCW0	1.15e-105	324	462	0.351	0.359	KREM2_HUMAN Kremen protein 2 OS=Homo sapiens OX=9606 GN=KREMEN2 PE=2 SV=1
4	Q8K1S7	3.01e-98	305	461	0.319	0.328	KREM2_MOUSE Kremen protein 2 OS=Mus musculus OX=10090 GN=Kremen2 PE=1 SV=1
5	Q14520	2.57e-15	80.5	560	0.076	0.064	HABP2_HUMAN Hyaluronan-binding protein 2 OS=Homo sapiens OX=9606 GN=HABP2 PE=1 SV=1
6	P00750	1.85e-14	77.8	562	0.089	0.075	TPA_HUMAN Tissue-type plasminogen activator OS=Homo sapiens OX=9606 GN=PLAT PE=1 SV=1
7	Q6L711	2.40e-14	77.4	558	0.076	0.065	HABP2_RAT Hyaluronan-binding protein 2 OS=Rattus norvegicus OX=10116 GN=Habp2 PE=2 SV=1
8	Q28198	4.14e-14	77.0	566	0.082	0.069	TPA_BOVIN Tissue-type plasminogen activator OS=Bos taurus OX=9913 GN=PLAT PE=2 SV=1
9	P19637	3.45e-13	73.9	559	0.089	0.075	TPA_RAT Tissue-type plasminogen activator OS=Rattus norvegicus OX=10116 GN=Plat PE=2 SV=2
10	P11214	5.10e-13	73.6	559	0.080	0.068	TPA_MOUSE Tissue-type plasminogen activator OS=Mus musculus OX=10090 GN=Plat PE=1 SV=3
11	Q01177	1.82e-12	72.0	812	0.123	0.071	PLMN_RAT Plasminogen OS=Rattus norvegicus OX=10116 GN=Plg PE=2 SV=2
12	Q80T79	1.83e-11	69.3	3707	0.091	0.012	CSMD3_MOUSE CUB and sushi domain-containing protein 3 OS=Mus musculus OX=10090 GN=Csmd3 PE=1 SV=3
13	P20918	1.99e-11	68.9	812	0.116	0.068	PLMN_MOUSE Plasminogen OS=Mus musculus OX=10090 GN=Plg PE=1 SV=3
14	P98066	2.00e-11	66.6	277	0.082	0.141	TSG6_HUMAN Tumor necrosis factor-inducible gene 6 protein OS=Homo sapiens OX=9606 GN=TNFAIP6 PE=1 SV=2
15	P06869	4.71e-11	67.0	433	0.070	0.076	UROK_MOUSE Urokinase-type plasminogen activator OS=Mus musculus OX=10090 GN=Plau PE=1 SV=1
16	Q9R098	7.23e-11	67.0	653	0.076	0.055	HGFA_MOUSE Hepatocyte growth factor activator OS=Mus musculus OX=10090 GN=Hgfac PE=1 SV=1
17	P06868	9.24e-11	66.6	812	0.106	0.062	PLMN_BOVIN Plasminogen OS=Bos taurus OX=9913 GN=PLG PE=1 SV=2
18	B0BN34	1.04e-10	64.7	275	0.089	0.153	B0BN34_RAT TNF alpha induced protein 6 OS=Rattus norvegicus OX=10116 GN=Tnfaip6 PE=4 SV=1
19	P29598	1.45e-10	65.5	432	0.068	0.074	UROK_RAT Urokinase-type plasminogen activator OS=Rattus norvegicus OX=10116 GN=Plau PE=1 SV=1
20	G1NJS7	2.16e-10	64.7	404	0.074	0.087	G1NJS7_MELGA Uncharacterized protein OS=Meleagris gallopavo OX=9103 PE=4 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00431 CUB	2.4e-14	65.0	CUB domain
2	PF00051 Kringle	1.5e-15	68.6	Kringle domain
3	PF01822 WSC	1.4e-14	65.3	WSC domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 60711.ENSCSAP00000006108

Rank	PPI partner	STRING score	Description
1	60711.ENSCSAP00000003323	0.913	Dickkopf WNT signaling pathway inhibitor 1
2	60711.ENSCSAP00000004889	0.895	Component of the Wnt-Fzd-LRP5-LRP6 complex that triggers beta-catenin signaling through inducing aggregation of receptor-ligand complexes into ribosome-sized signalsomes.
3	60711.ENSCSAP00000005238	0.864	Low density lipoprotein receptor-related protein 5
4	60711.ENSCSAP00000000341	0.836	Dickkopf WNT signaling pathway inhibitor 2
5	60711.ENSCSAP00000000992	0.758	Dickkopf WNT signaling pathway inhibitor 3
6	60711.ENSCSAP00000011136	0.746	Dickkopf WNT signaling pathway inhibitor 4
7	60711.ENSCSAP00000002514	0.708	Ligand for members of the frizzled family of seven transmembrane receptors
8	60711.ENSCSAP00000006553	0.656	Receptor for Dickkopf proteins. Cooperates with DKK1/2 to inhibit Wnt/beta-catenin signaling by promoting the endocytosis of Wnt receptors LRP5 and LRP6
9	60711.ENSCSAP00000012510	0.636	Ligand for members of the frizzled family of seven transmembrane receptors
10	60711.ENSCSAP00000018633	0.600	Frizzled class receptor 1
11	60711.ENSCSAP00000001999	0.580	Low density lipoprotein receptor-related protein 4
12	60711.ENSCSAP00000016201	0.577	Polymerase (DNA directed), epsilon, catalytic subunit
13	60711.ENSCSAP00000015699	0.573	Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene- specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors
14	60711.ENSCSAP00000018534	0.573	Frizzled class receptor 2
15	60711.ENSCSAP00000003134	0.565	Phospholipase A2, group XVI
16	60711.ENSCSAP00000009421	0.539	Ligand for members of the frizzled family of seven transmembrane receptors
17	60711.ENSCSAP00000001919	0.533	Ligand for members of the frizzled family of seven transmembrane receptors
18	60711.ENSCSAP00000006183	0.518	Zinc and ring finger 3
19	60711.ENSCSAP00000003140	0.503	Low density lipoprotein receptor

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0060089	0.369	molecular transducer activity
GO:0038023	0.363	signaling receptor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.994	cellular process
GO:0050789	0.985	regulation of biological process
GO:0032501	0.964	multicellular organismal process
GO:0048856	0.946	anatomical structure development
GO:0050794	0.931	regulation of cellular process
GO:0048519	0.908	negative regulation of biological process
GO:0007275	0.881	multicellular organism development
GO:0048523	0.874	negative regulation of cellular process
GO:0048583	0.855	regulation of response to stimulus
GO:0007154	0.767	cell communication
GO:0023051	0.695	regulation of signaling
GO:0010646	0.694	regulation of cell communication
GO:0009966	0.684	regulation of signal transduction
GO:0050896	0.668	response to stimulus
GO:0050793	0.658	regulation of developmental process
GO:0030111	0.565	regulation of Wnt signaling pathway
GO:0051239	0.541	regulation of multicellular organismal process
GO:0060828	0.518	regulation of canonical Wnt signaling pathway
GO:0051716	0.506	cellular response to stimulus
GO:0023052	0.499	signaling
GO:0048585	0.465	negative regulation of response to stimulus
GO:0051128	0.464	regulation of cellular component organization
GO:0007165	0.456	signal transduction
GO:0030278	0.423	regulation of ossification
GO:0048731	0.416	system development
GO:0030178	0.335	negative regulation of Wnt signaling pathway
GO:0051093	0.334	negative regulation of developmental process
GO:0090090	0.332	negative regulation of canonical Wnt signaling pathway
GO:0048518	0.320	positive regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0110165	1.000	cellular anatomical entity
GO:0005575	1.000	cellular_component
GO:0016020	0.992	membrane
GO:0071944	0.741	cell periphery
GO:0005737	0.705	cytoplasm
GO:0005886	0.704	plasma membrane
GO:0043226	0.505	organelle
GO:0036477	0.328	somatodendritic compartment
GO:0044297	0.311	cell body

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]