StarFunc result for job id Q96MX0

User Input

>input (182 residues)
MWPPDPDPDPDPEPAGGSRPGPAVPGLRALLPARAFLCSLKGRLLLAESGLSFITFICYV
ASSASAFLTAPLLEFLLALYFLFADAMQLNDKWQGLCWPMMDFLRCVTAALIYFAISITA
IAKYSDGASKAAGVFGFFATIVFATDFYLIFNDVAKFLKQGDSADETTAHKTEEENSDSD
SD

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q96MX0	1.000	1.000	2.110E-25	182	1.000	1.000	Q96MX0.pdb.gz	CKLF3_HUMAN CKLF-like MARVEL transmembrane domain-containing protein 3 OS=Homo sapiens OX=9606 GN=CMTM3 PE=1 SV=1
2	AFDB:Q99LJ5	0.577	0.572	6.467E-16	184	0.885	0.875	Q99LJ5.pdb.gz	CKLF3_MOUSE CKLF-like MARVEL transmembrane domain-containing protein 3 OS=Mus musculus OX=10090 GN=Cmtm3 PE=2 SV=1
3	AFDB:Q04941	0.639	0.758	4.081E-8	152	0.231	0.276	Q04941.pdb.gz	PLP2_HUMAN Proteolipid protein 2 OS=Homo sapiens OX=9606 GN=PLP2 PE=1 SV=1
4	AFDB:Q8IZR5	0.744	0.589	6.741E-7	234	0.258	0.201	Q8IZR5.pdb.gz	CKLF4_HUMAN CKLF-like MARVEL transmembrane domain-containing protein 4 OS=Homo sapiens OX=9606 GN=CMTM4 PE=1 SV=1
5	AFDB:Q9UBR5	0.623	0.738	2.640E-5	152	0.126	0.151	Q9UBR5.pdb.gz	CKLF_HUMAN Chemokine-like factor OS=Homo sapiens OX=9606 GN=CKLF PE=1 SV=1
6	AFDB:Q9D6G9	0.454	0.512	2.940E-5	156	0.324	0.378	Q9D6G9.pdb.gz	CKLF5_MOUSE CKLF-like MARVEL transmembrane domain-containing protein 5 OS=Mus musculus OX=10090 GN=Cmtm5 PE=1 SV=1
7	AFDB:A3KQ86	0.664	0.696	6.256E-5	173	0.170	0.179	A3KQ86.pdb.gz	A3KQ86_DANRE Novel protein similar to vertebrate transmembrane 4 superfamily member 11 (Plasmolipin) (TM4SF11) OS=Danio rerio OX=7955 GN=si:dkey-73n10.4 PE=4 SV=1
8	AFDB:Q8IZV2	0.680	0.713	7.763E-5	173	0.148	0.156	Q8IZV2.pdb.gz	CKLF8_HUMAN CKLF-like MARVEL transmembrane domain-containing protein 8 OS=Homo sapiens OX=9606 GN=CMTM8 PE=1 SV=2
9	AFDB:Q9NX76	0.732	0.729	7.763E-5	183	0.209	0.208	Q9NX76.pdb.gz	CKLF6_HUMAN CKLF-like MARVEL transmembrane domain-containing protein 6 OS=Homo sapiens OX=9606 GN=CMTM6 PE=1 SV=1
10	AFDB:Q9Y342	0.707	0.707	9.632E-5	182	0.154	0.154	Q9Y342.pdb.gz	PLLP_HUMAN Plasmolipin OS=Homo sapiens OX=9606 GN=PLLP PE=1 SV=1
11	PDB:1yo7A	0.501	0.716	1.610E-1	120	0.077	0.117	1yo7A.pdb.gz	Structure of the ColE1 rop protein at 1.7 A resolution
12	PDB:6g79S	0.275	0.210	3.075E-1	262	0.110	0.076	6g79S.pdb.gz	Cryo-EM structure of the serotonin 5-HT1Breceptor coupled to heterotrimeric Go.
13	PDB:7jvrR	0.277	0.208	6.542E-1	269	0.110	0.074	7jvrR.pdb.gz	Structural insights into the human D1 and D2 dopamine receptor signaling complexes.
14	PDB:6iblA	0.313	0.169	7.287E-1	397	0.077	0.035	6iblA.pdb.gz	Molecular basis of beta-arrestin coupling to formoterol-bound beta1-adrenoceptor.
15	PDB:5sv0A	0.184	0.148	7.691E-1	233	0.137	0.107	5sv0A.pdb.gz
16	PDB:7e33R	0.295	0.222	7.691E-1	257	0.104	0.074	7e33R.pdb.gz	Structural insights into the lipid and ligand regulation of serotonin receptors.
17	PDB:7u8gB	0.355	0.452	1.063	132	0.077	0.106	7u8gB.pdb.gz	Structure of the core human NADPH oxidase NOX2.
18	PDB:6bqrA	0.196	0.058	1.184	948	0.093	0.018	6bqrA.pdb.gz	Structure of the human TRPM4 ion channel in a lipid nanodisc.
19	PDB:3uonA	0.267	0.133	1.319	438	0.071	0.030	3uonA.pdb.gz	Structure of the human M2 muscarinic acetylcholine receptor bound to an antagonist.
20	PDB:7x9cR	0.281	0.194	1.392	302	0.099	0.060	7x9cR.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q96MX0	2.74e-131	367	182	1.000	1.000	CKLF3_HUMAN CKLF-like MARVEL transmembrane domain-containing protein 3 OS=Homo sapiens OX=9606 GN=CMTM3 PE=1 SV=1
2	Q99LJ5	1.09e-108	310	184	0.885	0.875	CKLF3_MOUSE CKLF-like MARVEL transmembrane domain-containing protein 3 OS=Mus musculus OX=10090 GN=Cmtm3 PE=2 SV=1
3	Q9D6G9	1.66e-24	95.5	156	0.319	0.372	CKLF5_MOUSE CKLF-like MARVEL transmembrane domain-containing protein 5 OS=Mus musculus OX=10090 GN=Cmtm5 PE=1 SV=1
4	Q04941	3.15e-12	63.2	152	0.203	0.243	PLP2_HUMAN Proteolipid protein 2 OS=Homo sapiens OX=9606 GN=PLP2 PE=1 SV=1
5	Q8IZR5	3.02e-06	48.1	234	0.258	0.201	CKLF4_HUMAN CKLF-like MARVEL transmembrane domain-containing protein 4 OS=Homo sapiens OX=9606 GN=CMTM4 PE=1 SV=1
6	Q96DZ9	1.93e-05	45.8	223	0.170	0.139	CKLF5_HUMAN CKLF-like MARVEL transmembrane domain-containing protein 5 OS=Homo sapiens OX=9606 GN=CMTM5 PE=1 SV=2
7	Q9UBR5	0.004	38.5	152	0.126	0.151	CKLF_HUMAN Chemokine-like factor OS=Homo sapiens OX=9606 GN=CKLF PE=1 SV=1
8	Q53FR4	0.005	39.3	796	0.198	0.045	Q53FR4_HUMAN Vacuolar protein sorting 35 variant (Fragment) OS=Homo sapiens OX=9606 PE=2 SV=1
9	Q9JK79	0.006	37.7	151	0.110	0.132	CKLF_RAT Chemokine-like factor OS=Rattus norvegicus OX=10116 GN=Cklf PE=2 SV=1
10	G3V8A5	0.007	38.9	796	0.198	0.045	G3V8A5_RAT Vacuolar protein sorting-associated protein 35 OS=Rattus norvegicus OX=10116 GN=Vps35 PE=1 SV=1
11	Q9EQH3	0.009	38.5	796	0.198	0.045	VPS35_MOUSE Vacuolar protein sorting-associated protein 35 OS=Mus musculus OX=10090 GN=Vps35 PE=1 SV=1
12	Q96QK1	0.038	36.6	796	0.192	0.044	VPS35_HUMAN Vacuolar protein sorting-associated protein 35 OS=Homo sapiens OX=9606 GN=VPS35 PE=1 SV=2
13	Q9NX76	0.79	32.0	183	0.236	0.235	CKLF6_HUMAN CKLF-like MARVEL transmembrane domain-containing protein 6 OS=Homo sapiens OX=9606 GN=CMTM6 PE=1 SV=1
14	P54309	4.7	30.0	503	0.082	0.030	PORTL_BPSPP Portal protein OS=Bacillus phage SPP1 OX=10724 GN=6 PE=1 SV=1
15	O00499	5.5	30.0	593	0.071	0.022	BIN1_HUMAN Myc box-dependent-interacting protein 1 OS=Homo sapiens OX=9606 GN=BIN1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF19606 DUF6111	1.9e+02	13.8	Family of unknown function (DUF6111)
2	PF01284 MARVEL	7.1e-06	37.6	Membrane-associating domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000400482

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000333833	0.938	CKLF like MARVEL transmembrane domain containing 4
2	9606.ENSP00000264001	0.913	Chemokine-like factor
3	9606.ENSP00000268595	0.909	CKLF like MARVEL transmembrane domain containing 2
4	9606.ENSP00000368814	0.909	CKLF like MARVEL transmembrane domain containing 1
5	9606.ENSP00000307741	0.806	CKLF like MARVEL transmembrane domain containing 8
6	9606.ENSP00000335605	0.747	CKLF like MARVEL transmembrane domain containing 7
7	9606.ENSP00000305790	0.741	Splicing factor 3B subunit 3
8	9606.ENSP00000264170	0.724	Kynureninase
9	9606.ENSP00000336127	0.556	Tetratricopeptide repeat protein 7B
10	9606.ENSP00000224337	0.544	B-cell linker protein
11	9606.ENSP00000046794	0.526	Lymphocyte cytosolic protein 2
12	9606.ENSP00000205636	0.518	CKLF like MARVEL transmembrane domain containing 6
13	9606.ENSP00000317955	0.515	Early endosome antigen 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0065007	0.993	biological regulation
GO:0050789	0.976	regulation of biological process
GO:0048518	0.968	positive regulation of biological process
GO:0050794	0.935	regulation of cellular process
GO:0048583	0.930	regulation of response to stimulus
GO:0032501	0.924	multicellular organismal process
GO:0048856	0.898	anatomical structure development
GO:0048584	0.873	positive regulation of response to stimulus
GO:0050776	0.865	regulation of immune response
GO:0023051	0.846	regulation of signaling
GO:0010646	0.843	regulation of cell communication
GO:0071684	0.807	organism emergence from protective structure
GO:0035188	0.804	hatching
GO:0048522	0.796	positive regulation of cellular process
GO:0009966	0.710	regulation of signal transduction
GO:0001824	0.667	blastocyst development
GO:0023056	0.585	positive regulation of signaling
GO:0010647	0.582	positive regulation of cell communication
GO:0009967	0.532	positive regulation of signal transduction
GO:0009987	0.458	cellular process
GO:0002684	0.416	positive regulation of immune system process
GO:0050854	0.394	regulation of antigen receptor-mediated signaling pathway
GO:0050778	0.355	positive regulation of immune response

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0043231	1.000	intracellular membrane-bounded organelle
GO:0012505	0.998	endomembrane system
GO:0005634	0.994	nucleus
GO:0016020	0.993	membrane
GO:0005829	0.974	cytosol
GO:0031090	0.707	organelle membrane
GO:0031982	0.706	vesicle
GO:0031410	0.703	cytoplasmic vesicle
GO:0070013	0.468	intracellular organelle lumen
GO:0031975	0.436	envelope
GO:0031967	0.427	organelle envelope
GO:0005635	0.380	nuclear envelope
GO:0031981	0.376	nuclear lumen
GO:0005654	0.344	nucleoplasm
GO:0031965	0.308	nuclear membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]