StarFunc result for job id Q96MY7

User Input

>input (647 residues)
MTVGRPEGAPGGAEGSRQIFPPESFADTEAGEELSGDGLVLPRASKLDEFLSPEEEIDST
SDSTGSIYQNLQELKQKGRWCLLESLFQSDPESDENLSEDEEDLESFFQDKDRGMVQVQC
PQALRCGSTRRCSSLNNLPSNIPRPQTQPPSGSRPPSQHRSVSSWASSITVPRPFRMTLR
EARKKAEWLGSPASFEQERQRAQRQGEEEAECHRQFRAQPVPAHVYLPLYQEIMERSEAR
RQAGIQKRKELLLSSLKPFSFLEKEEQLKEAARQRDLAATAEAKISKQKATRRIPKSILE
PALGDKLQEAELFRKIRIQMRALDMLQMASSPIASSSNRANPQPRTATRTQQEKLGFLHT
NFRFQPRVNPVVPDYEGLYKAFQRRAAKRRETQEATRNKPFLLRTANLRHPQRPCDAATT
GRRQDSPQPPATPLPRSRSLSGLASLSANTLPVHITDATRKRESAVRSALEKKNKADESI
QWLEIHKKKSQAMSKSVTLRAKAMDPHKSLEEVFKAKLKENRNNDRKRAKEYKKELEEMK
QRIQTRPYLFEQVAKDLAKKEAEQWYLDTLKQAGLEEDFVRNKGQGTRAVQEKETKIKDF
PRFQETTKLSIRDPEQGLEGSLEQPASPRKVLEELSHQSPENLVSLA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q96MY7	1.000	1.000	3.342E-96	647	1.000	1.000	Q96MY7.pdb.gz	F161B_HUMAN Protein FAM161B OS=Homo sapiens OX=9606 GN=FAM161B PE=1 SV=2
2	AFDB:Q3SY00	0.126	0.144	2.965E-6	556	0.164	0.191	Q3SY00.pdb.gz	T10IP_HUMAN Testis-specific protein 10-interacting protein OS=Homo sapiens OX=9606 GN=TSGA10IP PE=1 SV=2
3	AFDB:Q9URY2	0.106	0.133	1.707E-4	474	0.121	0.165	Q9URY2.pdb.gz	ALP7_SCHPO Microtubule protein alp7 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=alp7 PE=1 SV=1
4	AFDB:P39734	0.090	0.106	1.816E-3	528	0.119	0.146	P39734.pdb.gz	HPH2_YEAST Protein HPH2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=FRT2 PE=1 SV=2
5	AFDB:O94488	0.096	0.064	4.675E-3	1115	0.127	0.074	O94488.pdb.gz	MBO1_SCHPO Microtubule organizer protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mbo1 PE=1 SV=1
6	AFDB:Q99MI1	0.123	0.074	7.012E-3	1120	0.130	0.075	Q99MI1.pdb.gz	RB6I2_MOUSE ELKS/Rab6-interacting/CAST family member 1 OS=Mus musculus OX=10090 GN=Erc1 PE=1 SV=1
7	AFDB:Q386I1	0.109	0.080	7.502E-3	932	0.156	0.108	Q386I1.pdb.gz	Q386I1_TRYB2 Centromere protein J C-terminal domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.02.0810 PE=3 SV=1
8	AFDB:A0A480NP79	0.109	0.124	8.587E-3	549	0.141	0.166	A0A480NP79.pdb.gz	CFA45_PIG Cilia- and flagella-associated protein 45 OS=Sus scrofa OX=9823 GN=CFAP45 PE=1 SV=1
9	AFDB:E1JJ71	0.102	0.098	8.587E-3	679	0.119	0.113	E1JJ71.pdb.gz	E1JJ71_DROME Dementin, isoform H OS=Drosophila melanogaster OX=7227 GN=Dmtn PE=3 SV=1
10	AFDB:F1Q8W0	0.057	0.053	8.587E-3	835	0.153	0.119	F1Q8W0.pdb.gz	CATIN_DANRE Splicing factor Cactin OS=Danio rerio OX=7955 GN=cactin PE=2 SV=1
11	PDB:7mqaSS	0.047	0.071	2.921	350	0.051	0.094	7mqaSS.pdb.gz	Nucleolar maturation of the human small subunit processome.
12	PDB:2p01A	0.062	0.109	3.578	323	0.066	0.133	2p01A.pdb.gz
13	PDB:7lbmr	0.068	0.048	3.578	1034	0.037	0.023	7lbmr.pdb.gz	Structure of the human Mediator-bound transcription preinitiation complex.
14	PDB:7mqaNA	0.060	0.124	4.095	295	0.073	0.159	7mqaNA.pdb.gz	Nucleolar maturation of the human small subunit processome.
15	PDB:7emfN	0.065	0.045	4.688	1017	0.043	0.028	7emfN.pdb.gz	Structures of the human Mediator and Mediator-bound preinitiation complex.
16	PDB:6bk8E	0.046	0.155	5.366	186	0.045	0.156	6bk8E.pdb.gz	Structure of the yeast spliceosomal postcatalytic P complex.
17	PDB:5yzgL	0.085	0.122	5.741	419	0.116	0.179	5yzgL.pdb.gz	Structure of a human catalytic step I spliceosome
18	PDB:6lss4	0.067	0.069	7.030	620	0.048	0.050	6lss4.pdb.gz	Structural snapshots of human pre-60S ribosomal particles before and after nuclear export.
19	PDB:6n8lb	0.067	0.146	7.030	248	0.036	0.093	6n8lb.pdb.gz	Tightly-orchestrated rearrangements govern catalytic center assembly of the ribosome.
20	PDB:7c4jC	0.048	0.166	7.030	154	0.028	0.117	7c4jC.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q96MY7	0.0	1316	647	1.000	1.000	F161B_HUMAN Protein FAM161B OS=Homo sapiens OX=9606 GN=FAM161B PE=1 SV=2
2	Q3B820	3.31e-29	125	660	0.168	0.165	F161A_HUMAN Protein FAM161A OS=Homo sapiens OX=9606 GN=FAM161A PE=1 SV=2
3	Q8QZV6	2.26e-24	109	475	0.102	0.139	F161A_MOUSE Protein FAM161A OS=Mus musculus OX=10090 GN=Fam161a PE=1 SV=2
4	Q6AY14	3.87e-24	108	474	0.114	0.156	F161A_RAT Protein FAM161A OS=Rattus norvegicus OX=10116 GN=Fam161a PE=2 SV=2
5	Q3SY00	1.29e-04	47.4	556	0.056	0.065	T10IP_HUMAN Testis-specific protein 10-interacting protein OS=Homo sapiens OX=9606 GN=TSGA10IP PE=1 SV=2
6	Q9XX47	3.49e-04	46.2	814	0.176	0.140	F161_CAEEL Protein fam-161 OS=Caenorhabditis elegans OX=6239 GN=famh-161 PE=1 SV=1
7	Q381C2	7.32e-04	45.1	775	0.104	0.086	Q381C2_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.8370 PE=3 SV=1
8	Q586C0	0.12	37.7	530	0.036	0.043	Q586C0_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=1F7.345 PE=4 SV=1
9	F1LPI5	0.24	37.0	1172	0.088	0.049	F1LPI5_RAT Laminin subunit beta 3 OS=Rattus norvegicus OX=10116 GN=Lamb3 PE=4 SV=2
10	Q75V66	0.83	35.4	913	0.034	0.024	ANO5_HUMAN Anoctamin-5 OS=Homo sapiens OX=9606 GN=ANO5 PE=1 SV=1
11	Q9VXM0	2.1	34.3	2009	0.022	0.007	Q9VXM0_DROME LDL receptor related protein 4, isoform B OS=Drosophila melanogaster OX=7227 GN=Lrp4 PE=4 SV=1
12	P08200	4.5	32.7	416	0.029	0.046	IDH_ECOLI Isocitrate dehydrogenase [NADP] OS=Escherichia coli (strain K12) OX=83333 GN=icd PE=1 SV=1
13	C9J5J4	8.7	32.0	489	0.039	0.051	C9J5J4_HUMAN Lin-9 DREAM MuvB core complex component OS=Homo sapiens OX=9606 GN=LIN9 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF10228 DUF2228	9.3e+02	10.9	Uncharacterised conserved protein (DUF2228)
2	PF10595 UPF0564	5.9e-91	316.8	Uncharacterised protein family UPF0564

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000286544

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000377369	0.782	Leucine-rich repeat-containing protein 74A
2	9606.ENSP00000310593	0.770	Microtubule-associated protein 9
3	9606.ENSP00000348714	0.763	Apoptosis-resistant E3 ubiquitin protein ligase 1
4	9606.ENSP00000344393	0.759	rRNA-processing protein FCF1 homolog
5	9606.ENSP00000452280	0.723	Prostaglandin reductase 2
6	9606.ENSP00000451812	0.693	Protein lin-52 homolog
7	9606.ENSP00000355499	0.662	Serologically defined colon cancer antigen 8
8	9606.ENSP00000292401	0.618	Zinc-alpha-2-glycoprotein
9	9606.ENSP00000477548	0.600	Orexin receptor type 2
10	9606.ENSP00000376686	0.581	Lebercilin
11	9606.ENSP00000380659	0.575	Eukaryotic translation initiation factor 4E transporter
12	9606.ENSP00000298299	0.533	Zinc finger protein 22
13	9606.ENSP00000342699	0.518	Cilia- and flagella-associated protein 36

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0044782	0.996	cilium organization
GO:0050789	0.966	regulation of biological process
GO:0070925	0.889	organelle assembly
GO:0050794	0.808	regulation of cellular process
GO:0060271	0.786	cilium assembly
GO:0019222	0.441	regulation of metabolic process
GO:0048518	0.383	positive regulation of biological process
GO:0051171	0.378	regulation of nitrogen compound metabolic process
GO:0060255	0.376	regulation of macromolecule metabolic process
GO:0080090	0.375	regulation of primary metabolic process
GO:0051173	0.374	positive regulation of nitrogen compound metabolic process
GO:0010604	0.373	positive regulation of macromolecule metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005881	0.998	cytoplasmic microtubule
GO:0043227	0.745	membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]