StarFunc result for job id Q96N23

User Input

>input (1400 residues)
MAAQGSPSSSPSDDSTTSGSLPELPPTSTATSRSPPESKGSSRSSLLQWTCPEDSLPLAV
FYGPLDAKNPLLASCEKEIQELLGFMRKKKALATTEEEKHEFRRRCATSLFNIWTKYAPR
LPADYYNEKLLKVGDSLCQMKEYKLALLQCYGRYLQQFNTNFDENKVDVTQFKATFFPKG
FKDKTAGLTFHALSGKNMCNYQLVCDSDENLKNKESVVQCLHILSSLRLIMQVALPQEHL
CWIIFNGTIYIYTICRKLMVIGQSSKALEYLLWASMCMESLVPLLSLRYLTWRATLYTAV
CQCCYDCHAGIHGEAFARRALAKIDELRQLELMSSSKSQEESRRYFREATMKMAVMIFKR
GVFESRRKNKAVFRPKIRINLREVQTLSWPRTVTERLLDEMFDSTASQFLAVLEALSDSN
RRILQTGPIVTDEVEIHDVVSELFMAGKELLIMSNIGADGMLDFPKTSLLELMIGRKDVI
SVDAAVKFIKLAFTYEEWSLFESSAVHLIYFLQRQDDPESKKAEKDLTLLIAMEPLINVK
RNKGLIFPLENYKEGQSTQIYLKKIAVHDTCLKTCGYSEDIFHLAATLYVCVCTAPQDVQ
PDKEIVVDTIMFLWQKCKLGIQRLNISRNDYAKFTQKISTNKWIYLLWQINEVIHCYKME
DIDIVVVAEVTLRLSEILESLGSPGRKFKQSLDVPLREGTNKFPGAPKGITEILPILQKN
PVEQLLFAYKLLDRAIGGINLNCMLTSLPNGSSVIDHCYAKRTHHIDGDTYKPLASNSFM
MDLHLELIQAQHRIAVVLLDKLQVLQTPTVSKDISTKGPEKLKQSGSTDCFTELNIMNKI
KKNTLSKAIYLMQKALLIFEKDATSTSSWELLMEAYSLIQRIEAEQNALYSYQKYLESSK
RKKSRVPPPPILLSRTHCSVTLKPAPFTSEVKVSWYCILGCKAEGSYGKVRLNNNHLPNS
GEAIPADGKSVFEVKGLETNEKYVFAVAAYSNNGKLVGGAIGETTKPILVYPPLSTITAR
MFLTQVAYQVGNYELAKKVFSPVWDYFVASPLQDEQSVICLSNIITITQRRLHSDILAET
SSILLYLFLRNIFVTSDIKIKEENLFCDNIKGNEIFPSQQIARLIECERVLVALELSNFL
NDSSYALQAVTQCYGLLAPIIYHNIVLVPVVQILIKCIVVLQGLPSIVCSKKHTASFESI
QHMIACCIFYITKILRSWREYDLAVMIINYGKKMLDITPGCKSLFDGSNEQEEMPEEDSS
KKSLKTKKPQQILLPEKINEQLALLETHLLKLTKQYVTSELSGGEDPIFLYPVVLNWSVK
GAVKEVMKFKQKPRFLEFFTQVMLKCMNEEKFHLMVEVTTPVHDFLKRRNESLLGLIKVK
YKDSALNKKANKSLKFKAAV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:7n6g1N	0.201	0.143	2.816E-6	2179	0.086	0.055	7n6g1N.pdb.gz	Cryo-EM structure of an active central apparatus.
2	PDB:7qdrB	0.149	0.161	4.185E-6	1212	0.084	0.097	7qdrB.pdb.gz
3	PDB:7cunG	0.189	0.260	4.354E-6	895	0.079	0.123	7cunG.pdb.gz	Identification of Integrator-PP2A complex (INTAC), an RNA polymerase II phosphatase.
4	PDB:7sqcR1	0.197	0.146	1.219E-5	2080	0.100	0.067	7sqcR1.pdb.gz	Ciliary central apparatus structure reveals mechanisms of microtubule patterning.
5	PDB:7mopA	0.109	0.075	1.373E-5	2445	0.115	0.066	7mopA.pdb.gz	Solenoid architecture of HUWE1 contributes to ligase activity and substrate recognition.
6	AFDB:B0M1H3	0.105	0.139	2.415E-5	936	0.081	0.121	B0M1H3.pdb.gz	ZIP4L_ARATH TPR repeat-containing protein ZIP4 OS=Arabidopsis thaliana OX=3702 GN=ZIP4 PE=2 SV=1
7	PDB:4bujB	0.112	0.114	5.715E-5	1367	0.089	0.091	4bujB.pdb.gz
8	AFDB:Q8INH7	0.083	0.084	9.285E-5	1384	0.106	0.108	Q8INH7.pdb.gz	Q8INH7_DROME Timeout OS=Drosophila melanogaster OX=7227 GN=timeout PE=1 SV=2
9	PDB:7dkhI	0.109	0.150	6.155E-4	914	0.077	0.118	7dkhI.pdb.gz
10	AFDB:Q9D2X5	0.107	0.190	7.000E-4	619	0.051	0.115	Q9D2X5.pdb.gz	SCC4_MOUSE MAU2 chromatid cohesion factor homolog OS=Mus musculus OX=10090 GN=Mau2 PE=1 SV=3
11	AFDB:Q8TEQ6	0.087	0.084	7.578E-4	1508	0.073	0.068	Q8TEQ6.pdb.gz	GEMI5_HUMAN Gem-associated protein 5 OS=Homo sapiens OX=9606 GN=GEMIN5 PE=1 SV=3
12	AFDB:F4IRR2	0.227	0.273	8.534E-4	1040	0.096	0.130	F4IRR2.pdb.gz	SAD2_ARATH Importin beta-like SAD2 OS=Arabidopsis thaliana OX=3702 GN=SAD2 PE=1 SV=1
13	PDB:7r5j00	0.106	0.158	1.306E-3	756	0.065	0.120	7r5j00.pdb.gz	AI-based structure prediction empowers integrative structural analysis of human nuclear pores
14	PDB:6x9oA	0.195	0.138	1.359E-3	2425	0.094	0.054	6x9oA.pdb.gz
15	PDB:7nj1A	0.163	0.158	1.359E-3	1448	0.086	0.083	7nj1A.pdb.gz
16	AFDB:Q9LZX8	0.093	0.078	1.811E-3	1793	0.114	0.089	Q9LZX8.pdb.gz	BIG2_ARATH Brefeldin A-inhibited guanine nucleotide-exchange protein 2 OS=Arabidopsis thaliana OX=3702 GN=BIG2 PE=2 SV=1
17	AFDB:F1QVN7	0.179	0.255	2.297E-3	855	0.079	0.129	F1QVN7.pdb.gz
18	AFDB:Q9FPW0	0.138	0.208	3.031E-3	782	0.059	0.105	Q9FPW0.pdb.gz	Q9FPW0_CHLRE Intraflagellar transport particle protein IFT88 OS=Chlamydomonas reinhardtii OX=3055 GN=IFT88 PE=2 SV=1
19	AFDB:G5ED37	0.154	0.220	3.695E-3	820	0.061	0.104	G5ED37.pdb.gz	G5ED37_CAEEL Intraflagellar transport protein 88 homolog OS=Caenorhabditis elegans OX=6239 GN=osm-5 PE=2 SV=1
20	AFDB:Q961G1	0.055	0.072	3.845E-3	905	0.067	0.104	Q961G1.pdb.gz	COG3_DROME Conserved oligomeric Golgi complex subunit 3 OS=Drosophila melanogaster OX=7227 GN=Cog3 PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8C6S9	0.0	2190	3106	0.749	0.337	CFA54_MOUSE Cilia- and flagella-associated protein 54 OS=Mus musculus OX=10090 GN=Cfap54 PE=2 SV=4
2	A8J666	1.84e-18	94.7	3081	0.052	0.024	CFA54_CHLRE Cilia- and flagella-associated protein 54 OS=Chlamydomonas reinhardtii OX=3055 GN=CFAP54 PE=1 SV=1
3	Q382P8	5.28e-07	57.4	3963	0.026	0.009	Q382P8_TRYB2 Non-specific serine/threonine protein kinase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.52.0002 PE=4 SV=1
4	Q6NLP2	0.20	38.5	520	0.027	0.073	IF31_ARATH Translation initiation factor IF3-1, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=IF3-1 PE=2 SV=1
5	A1L1S9	1.2	36.2	1311	0.026	0.028	A1L1S9_DANRE [histone H3]-trimethyl-L-lysine(27) demethylase OS=Danio rerio OX=7955 GN=utxl1 PE=2 SV=1
6	P27296	1.5	35.8	716	0.036	0.070	DING_ECOLI ATP-dependent DNA helicase DinG OS=Escherichia coli (strain K12) OX=83333 GN=dinG PE=1 SV=3
7	P0C492	1.9	33.5	136	0.010	0.103	RR8_ORYSA Small ribosomal subunit protein uS8c OS=Oryza sativa OX=4530 GN=rps8 PE=3 SV=1
8	P0C493	1.9	33.5	136	0.010	0.103	RR8_ORYSI Small ribosomal subunit protein uS8c OS=Oryza sativa subsp. indica OX=39946 GN=rps8 PE=3 SV=1
9	P0C494	1.9	33.5	136	0.010	0.103	RR8_ORYSJ Small ribosomal subunit protein uS8c OS=Oryza sativa subsp. japonica OX=39947 GN=rps8 PE=3 SV=1
10	Q6END8	1.9	33.5	136	0.010	0.103	RR8_ORYNI Small ribosomal subunit protein uS8c OS=Oryza nivara OX=4536 GN=rps8 PE=3 SV=1
11	F1Q597	2.4	35.0	1452	0.026	0.025	F1Q597_DANRE [histone H3]-trimethyl-L-lysine(27) demethylase OS=Danio rerio OX=7955 GN=kdm6a PE=1 SV=2
12	Q66GN3	4.4	34.3	739	0.018	0.034	NPGR2_ARATH Protein NPGR2 OS=Arabidopsis thaliana OX=3702 GN=NPGR2 PE=1 SV=1
13	P04415	7.2	33.5	898	0.015	0.023	DPOL_BPT4 DNA-directed DNA polymerase OS=Enterobacteria phage T4 OX=10665 GN=43 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF14858 CFAP54_N	5.7e-277	931.1	Cilia- and flagella-associated protein 54
2	PF00041 fn3	3.1e+02	13.1	Fibronectin type III domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000431759

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000393222	0.882	Cilia- and flagella-associated protein 221
2	9606.ENSP00000348314	0.769	Sperm flagellar protein 2
3	9606.ENSP00000357575	0.768	Cilia- and flagella-associated protein 46
4	9606.ENSP00000248306	0.753	Methyltransferase-like protein 25
5	9606.ENSP00000344446	0.733	FYVE, RhoGEF and PH domain-containing protein 6
6	9606.ENSP00000405708	0.680	Coiled-coil domain-containing protein 39
7	9606.ENSP00000261205	0.660	Synaptotagmin-1
8	9606.ENSP00000298925	0.643	Protein kinase C-binding protein NELL1
9	9606.ENSP00000417061	0.615	Cilia- and flagella-associated protein 74
10	9606.ENSP00000371037	0.574	Cation channel sperm-associated protein subunit delta
11	9606.ENSP00000309087	0.517	PLAC8-like protein 1
12	9606.ENSP00000268130	0.505	WD repeat-containing protein 93
13	9606.ENSP00000331474	0.503	Synapse differentiation-inducing gene protein 1-like
14	9606.ENSP00000348496	0.501	SUN domain-containing protein 5

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0070925	0.978	organelle assembly
GO:0120031	0.978	plasma membrane bounded cell projection assembly
GO:0060271	0.974	cilium assembly
GO:0032501	0.948	multicellular organismal process
GO:0003341	0.940	cilium movement
GO:0007286	0.937	spermatid development
GO:0060294	0.927	cilium movement involved in cell motility
GO:0030317	0.917	flagellated sperm motility
GO:0044458	0.914	motile cilium assembly
GO:0099111	0.889	microtubule-based transport
GO:0006858	0.867	extracellular transport
GO:0120316	0.853	sperm flagellum assembly
GO:0007585	0.797	respiratory gaseous exchange by respiratory system
GO:0003351	0.789	epithelial cilium movement involved in extracellular fluid movement
GO:0003008	0.519	system process
GO:0051641	0.425	cellular localization
GO:0050877	0.377	nervous system process
GO:0051649	0.328	establishment of localization in cell

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043229	0.999	intracellular organelle
GO:0043227	0.997	membrane-bounded organelle
GO:0005737	0.965	cytoplasm
GO:0043231	0.953	intracellular membrane-bounded organelle
GO:0043228	0.895	non-membrane-bounded organelle
GO:0043232	0.894	intracellular non-membrane-bounded organelle
GO:0005856	0.617	cytoskeleton
GO:0120025	0.474	plasma membrane bounded cell projection
GO:0005634	0.426	nucleus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]