StarFunc result for job id Q96N67

User Input

>input (2140 residues)
MAERRAFAQKISRTVAAEVRKQISGQYSGSPQLLKNLNIVGNISHHTTVPLTEAVDPVDL
EDYLITHPLAVDSGPLRDLIEFPPDDIEVVYSPRDCRTLVSAVPEESEMDPHVRDCIRSY
TEDWAIVIRKYHKLGTGFNPNTLDKQKERQKGLPKQVFESDEAPDGNSYQDDQDDLKRRS
MSIDDTPRGSWACSIFDLKNSLPDALLPNLLDRTPNEEIDRQNDDQRKSNRHKELFALHP
SPDEEEPIERLSVPDIPKEHFGQRLLVKCLSLKFEIEIEPIFASLALYDVKEKKKISENF
YFDLNSEQMKGLLRPHVPPAAITTLARSAIFSITYPSQDVFLVIKLEKVLQQGDIGECAE
PYMIFKEADATKNKEKLEKLKSQADQFCQRLGKYRMPFAWTAIHLMNIVSSAGSLERDST
EVEISTGERKGSWSERRNSSIVGRRSLERTTSGDDACNLTSFRPATLTVTNFFKQEGDRL
SDEDLYKFLADMRRPSSVLRRLRPITAQLKIDISPAPENPHYCLTPELLQVKLYPDSRVR
PTREILEFPARDVYVPNTTYRNLLYIYPQSLNFANRQGSARNITVKVQFMYGEDPSNAMP
VIFGKSSCSEFSKEAYTAVVYHNRSPDFHEEIKVKLPATLTDHHHLLFTFYHVSCQQKQN
TPLETPVGYTWIPMLQNGRLKTGQFCLPVSLEKPPQAYSVLSPEVPLPGMKWVDNHKGVF
NVEVVAVSSIHTQDPYLDKFFALVNALDEHLFPVRIGDMRIMENNLENELKSSISALNSS
QLEPVVRFLHLLLDKLILLVIRPPVIAGQIVNLGQASFEAMASIINRLHKNLEGNHDQHG
RNSLLASYIHYVFRLPNTYPNSSSPGPGGLGGSVHYATMARSAVRPASLNLNRSRSLSNS
NPDISGTPTSPDDEVRSIIGSKGLDRSNSWVNTGGPKAAPWGSNPSPSAESTQAMDRSCN
RMSSHTETSSFLQTLTGRLPTKKLFHEELALQWVVCSGSVRESALQQAWFFFELMVKSMV
HHLYFNDKLEAPRKSRFPERFMDDIAALVSTIASDIVSRFQKDTEMVERLNTSLAFFLND
LLSVMDRGFVFSLIKSCYKQVSSKLYSLPNPSVLVSLRLDFLRIICSHEHYVTLNLPCSL
LTPPASPSPSVSSATSQSSGFSTNVQDQKIANMFELSVPFRQQHYLAGLVLTELAVILDP
DAEGLFGLHKKVINMVHNLLSSHDSDPRYSDPQIKARVAMLYLPLIGIIMETVPQLYDFT
ETHNQRGRPICIATDDYESESGSMISQTVAMAIAGTSVPQLTRPGSFLLTSTSGRQHTTF
SAESSRSLLICLLWVLKNADETVLQKWFTDLSVLQLNRLLDLLYLCVSCFEYKGKKVFER
MNSLTFKKSKDMRAKLEEAILGSIGARQEMVRRSRGQLGTYTIASPPERSPSGSAFGSQE
NLRWRKDMTHWRQNTEKLDKSRAEIEHEALIDGNLATEANLIILDTLEIVVQTVSVTESK
ESILGGVLKVLLHSMACNQSAVYLQHCFATQRALVSKFPELLFEEETEQCADLCLRLLRH
CSSSIGTIRSHASASLYLLMRQNFEIGNNFARVKMQVTMSLSSLVGTSQNFNEEFLRRSL
KTILTYAEEDLELRETTFPDQVQDLVFNLHMILSDTVKMKEHQEDPEMLIDLMYRIAKGY
QTSPDLRLTWLQNMAGKHSERSNHAEAAQCLVHSAALVAEYLSMLEDRKYLPVGCVTFQN
ISSNVLEESAVSDDVVSPDEEGICSGKYFTESGLVGLLEQAAASFSMAGMYEAVNEVYKV
LIPIHEANRDAKKLSTIHGKLQEAFSKIVHQSTGWERMFGTYFRVGFYGTKFGDLDEQEF
VYKEPAITKLAEISHRLEGFYGERFGEDVVEVIKDSNPVDKCKLDPNKAYIQITYVEPYF
DTYEMKDRITYFDKNYNLRRFMYCTPFTLDGRAHGELHEQFKRKTILTTSHAFPYIKTRV
NVTHKEEIILTPIEVAIEDMQKKTQELAFATHQDPADPKMLQMVLQGSVGTTVNQGPLEV
AQVFLSEIPSDPKLFRHHNKLRLCFKDFTKRCEDALRKNKSLIGPDQKEYQRELERNYHR
LKEALQPLINRKIPQLYKAVLPVTCHRDSFSRMSLRKMDL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A2AF47	0.497	0.509	0.000	2073	0.304	0.314	A2AF47.pdb.gz	DOC11_MOUSE Dedicator of cytokinesis protein 11 OS=Mus musculus OX=10090 GN=Dock11 PE=1 SV=1
2	AFDB:Q8BIK4	0.516	0.536	0.000	2055	0.289	0.301	Q8BIK4.pdb.gz	DOCK9_MOUSE Dedicator of cytokinesis protein 9 OS=Mus musculus OX=10090 GN=Dock9 PE=1 SV=2
3	AFDB:Q8BZN6	0.539	0.537	0.000	2150	0.277	0.276	Q8BZN6.pdb.gz	DOC10_MOUSE Dedicator of cytokinesis protein 10 OS=Mus musculus OX=10090 GN=Dock10 PE=1 SV=4
4	AFDB:Q8C147	0.832	0.847	0.000	2100	0.560	0.571	Q8C147.pdb.gz	DOCK8_MOUSE Dedicator of cytokinesis protein 8 OS=Mus musculus OX=10090 GN=Dock8 PE=1 SV=4
5	AFDB:Q96HP0	0.831	0.867	0.000	2047	0.648	0.677	Q96HP0.pdb.gz	DOCK6_HUMAN Dedicator of cytokinesis protein 6 OS=Homo sapiens OX=9606 GN=DOCK6 PE=1 SV=3
6	AFDB:Q96N67	1.000	1.000	0.000	2140	1.000	1.000	Q96N67.pdb.gz	DOCK7_HUMAN Dedicator of cytokinesis protein 7 OS=Homo sapiens OX=9606 GN=DOCK7 PE=1 SV=4
7	AFDB:Q9BZ29	0.518	0.533	0.000	2069	0.295	0.305	Q9BZ29.pdb.gz	DOCK9_HUMAN Dedicator of cytokinesis protein 9 OS=Homo sapiens OX=9606 GN=DOCK9 PE=1 SV=2
8	AFDB:Q86I66	0.470	0.446	2.694E-91	2284	0.247	0.231	Q86I66.pdb.gz	Q86I66_DICDI DOCK family protein OS=Dictyostelium discoideum OX=44689 GN=zizA PE=3 SV=1
9	AFDB:Q8SAB7	0.435	0.500	5.591E-76	1830	0.207	0.242	Q8SAB7.pdb.gz	SPK1_ARATH Guanine nucleotide exchange factor SPIKE 1 OS=Arabidopsis thaliana OX=3702 GN=SPK1 PE=1 SV=1
10	AFDB:Q580S2	0.337	0.300	4.172E-46	2463	0.143	0.125	Q580S2.pdb.gz	Q580S2_TRYB2 Tb-292 membrane associated protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb03.5L5.760 PE=3 SV=1
11	PDB:6tgbA	0.231	0.302	6.980E-20	1450	0.079	0.117	6tgbA.pdb.gz
12	PDB:7ay1A	0.061	0.102	9.949E-5	1033	0.060	0.125	7ay1A.pdb.gz	Structural basis of FANCD2 deubiquitination by USP1-UAF1.
13	PDB:3gjxA	0.060	0.093	1.861E-4	1041	0.052	0.108	3gjxA.pdb.gz	Crystal Structure of the Nuclear Export Receptor CRM1 in Complex with Snurportin1 and RanGTP.
14	PDB:7mqaLM	0.068	0.070	2.390E-4	2041	0.067	0.071	7mqaLM.pdb.gz	Nucleolar maturation of the human small subunit processome.
15	PDB:2x1gF	0.090	0.146	2.492E-4	896	0.047	0.112	2x1gF.pdb.gz
16	PDB:7tzcA	0.097	0.060	2.945E-4	4404	0.093	0.045	7tzcA.pdb.gz	A drug and ATP binding site in type 1 ryanodine receptor.
17	PDB:6vaeA	0.069	0.094	4.112E-4	1198	0.049	0.087	6vaeA.pdb.gz	DNA clamp function of the monoubiquitinated Fanconi anaemia ID complex.
18	PDB:7t3pA	0.062	0.063	4.112E-4	2066	0.049	0.051	7t3pA.pdb.gz	Structural basis for activation and gating of IP 3 receptors.
19	PDB:7mopA	0.110	0.099	4.470E-4	2445	0.072	0.063	7mopA.pdb.gz	Solenoid architecture of HUWE1 contributes to ligase activity and substrate recognition.
20	PDB:7sglA	0.057	0.041	4.860E-4	3852	0.069	0.038	7sglA.pdb.gz	Autophosphorylation transforms DNA-PK from protecting to processing DNA ends.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A2AF47	0.0	616	2073	0.185	0.191	DOC11_MOUSE Dedicator of cytokinesis protein 11 OS=Mus musculus OX=10090 GN=Dock11 PE=1 SV=1
2	K7ESB7	0.0	2835	2082	0.657	0.676	K7ESB7_HUMAN Dedicator of cytokinesis 6 OS=Homo sapiens OX=9606 GN=DOCK6 PE=1 SV=2
3	Q5JSL3	0.0	623	2073	0.182	0.188	DOC11_HUMAN Dedicator of cytokinesis protein 11 OS=Homo sapiens OX=9606 GN=DOCK11 PE=1 SV=2
4	Q8C147	0.0	2385	2100	0.566	0.577	DOCK8_MOUSE Dedicator of cytokinesis protein 8 OS=Mus musculus OX=10090 GN=Dock8 PE=1 SV=4
5	Q8NF50	0.0	2380	2099	0.564	0.576	DOCK8_HUMAN Dedicator of cytokinesis protein 8 OS=Homo sapiens OX=9606 GN=DOCK8 PE=1 SV=3
6	Q8R1A4	0.0	4362	2130	0.977	0.982	DOCK7_MOUSE Dedicator of cytokinesis protein 7 OS=Mus musculus OX=10090 GN=Dock7 PE=1 SV=3
7	Q96HP0	0.0	2764	2047	0.648	0.677	DOCK6_HUMAN Dedicator of cytokinesis protein 6 OS=Homo sapiens OX=9606 GN=DOCK6 PE=1 SV=3
8	Q96N67	0.0	4454	2140	1.000	1.000	DOCK7_HUMAN Dedicator of cytokinesis protein 7 OS=Homo sapiens OX=9606 GN=DOCK7 PE=1 SV=4
9	Q9VPI9	0.0	1218	2064	0.297	0.308	Q9VPI9_DROME LD20667p OS=Drosophila melanogaster OX=7227 GN=Zir PE=2 SV=2
10	Q8BIK4	5.21e-169	573	2055	0.175	0.182	DOCK9_MOUSE Dedicator of cytokinesis protein 9 OS=Mus musculus OX=10090 GN=Dock9 PE=1 SV=2
11	Q9BZ29	2.00e-168	572	2069	0.176	0.182	DOCK9_HUMAN Dedicator of cytokinesis protein 9 OS=Homo sapiens OX=9606 GN=DOCK9 PE=1 SV=2
12	Q96BY6	4.63e-164	561	2186	0.177	0.173	DOC10_HUMAN Dedicator of cytokinesis protein 10 OS=Homo sapiens OX=9606 GN=DOCK10 PE=1 SV=3
13	A0A2R8YD85	6.42e-164	560	2199	0.177	0.172	A0A2R8YD85_HUMAN Dedicator of cytokinesis 10 OS=Homo sapiens OX=9606 GN=DOCK10 PE=1 SV=1
14	Q8BZN6	4.97e-162	555	2187	0.175	0.171	DOC10_MOUSE Dedicator of cytokinesis protein 10 OS=Mus musculus OX=10090 GN=Dock10 PE=1 SV=4
15	M9PCG3	4.70e-128	452	2298	0.132	0.123	M9PCG3_DROME Zizimin, isoform K OS=Drosophila melanogaster OX=7227 GN=Ziz PE=1 SV=1
16	Q86I66	6.59e-116	414	2284	0.113	0.106	Q86I66_DICDI DOCK family protein OS=Dictyostelium discoideum OX=44689 GN=zizA PE=3 SV=1
17	Q54CA8	1.51e-86	318	2147	0.114	0.114	Q54CA8_DICDI DOCK family protein OS=Dictyostelium discoideum OX=44689 GN=zizB PE=3 SV=1
18	Q8SAB7	4.41e-51	202	1830	0.100	0.117	SPK1_ARATH Guanine nucleotide exchange factor SPIKE 1 OS=Arabidopsis thaliana OX=3702 GN=SPK1 PE=1 SV=1
19	Q8CIQ7	1.01e-13	80.1	2027	0.035	0.037	DOCK3_MOUSE Dedicator of cytokinesis protein 3 OS=Mus musculus OX=10090 GN=Dock3 PE=1 SV=1
20	Q8IZD9	1.48e-13	79.3	2030	0.036	0.038	DOCK3_HUMAN Dedicator of cytokinesis protein 3 OS=Homo sapiens OX=9606 GN=DOCK3 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF06920 DHR-2_Lobe_A	8.8e-54	193.5	DHR-2, Lobe A
2	PF20422 DHR-2_Lobe_B	6.8e-26	101.5	DHR-2, Lobe B
3	PF20421 DHR-2_Lobe_C	2e-35	132.1	DHR-2, Lobe C
4	PF14429 DOCK-C2	1.4e-45	167.0	C2 domain in Dock180 and Zizimin proteins
5	PF11878 DOCK_C-D_N	3.8e-32	122.5	Dedicator of cytokinesis C/D, N terminal
6	PF16172 DOCK_N	9.7	16.6	DOCK N-terminus

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9541.XP_005543243.1

Rank	PPI partner	STRING score	Description
1	9541.XP_005544567.1	0.866	Plasma membrane-associated small GTPase which cycles between an active GTP-bound and an inactive GDP-bound state. In active state binds to a variety of effector proteins to regulate cellular responses. Involved in epithelial cell polarization processes. Regulates the bipolar attachment of spindle microtubules to kinetochores before chromosome congression in metaphase. Regulates cell migration. In neurons, plays a role in the extension and maintenance of the formation of filopodia, thin and actin-rich surface projections (By similarity). Required for DOCK10-mediated spine formation in P [...]
2	9541.XP_005551797.1	0.840	Cell division control protein 42 homolog
3	9541.XP_005553184.1	0.840	Cell division control protein 42 homolog
4	9541.XP_005549554.1	0.777	Ras-related C3 botulinum toxin substrate 1
5	9541.XP_005595335.1	0.764	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 100% coverage of the annotated genomic feature by RNAseq alignments, including 12 samples with support for all annotated introns
6	9541.XP_005595489.1	0.764	Uncharacterized protein
7	9541.XP_005567948.1	0.722	Crk-like protein
8	9541.XP_005582485.1	0.710	CRK proto-oncogene, adaptor protein
9	9541.XP_005543283.1	0.696	Uncharacterized protein
10	9541.XP_005584091.1	0.679	Receptor protein-tyrosine kinase
11	9541.XP_005558107.1	0.672	Protein diaphanous homolog 1 isoform X1
12	9541.XP_005571238.1	0.656	Receptor tyrosine-protein kinase erbB-3
13	9541.XP_005552579.1	0.655	Uncharacterized protein
14	9541.XP_005583368.1	0.650	Coiled-coil domain-containing protein 55
15	9541.XP_005551320.1	0.648	RNA-binding protein 33 isoform X1
16	9541.XP_005562920.1	0.640	Dedicator of cytokinesis protein 5 isoform X1
17	9541.XP_005567434.1	0.633	Uncharacterized protein
18	9541.XP_005585469.1	0.633	Uncharacterized protein
19	9541.XP_005543269.1	0.627	inaD-like protein-like isoform X1
20	9541.XP_005563077.1	0.627	Uncharacterized protein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0031267	0.998	small GTPase binding
GO:0140677	0.946	molecular function activator activity
GO:0030234	0.944	enzyme regulator activity
GO:0140678	0.878	molecular function inhibitor activity
GO:0030695	0.828	GTPase regulator activity
GO:0005085	0.805	guanyl-nucleotide exchange factor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0065007	0.997	biological regulation
GO:0009987	0.997	cellular process
GO:0050794	0.990	regulation of cellular process
GO:0048518	0.971	positive regulation of biological process
GO:0032501	0.957	multicellular organismal process
GO:0030334	0.950	regulation of cell migration
GO:0071840	0.940	cellular component organization or biogenesis
GO:0016043	0.925	cellular component organization
GO:0048522	0.903	positive regulation of cellular process
GO:0048856	0.898	anatomical structure development
GO:0019222	0.889	regulation of metabolic process
GO:0007275	0.871	multicellular organism development
GO:0006996	0.853	organelle organization
GO:0051336	0.839	regulation of hydrolase activity
GO:0048731	0.831	system development
GO:0051345	0.799	positive regulation of hydrolase activity
GO:0007399	0.789	nervous system development
GO:0043087	0.781	regulation of GTPase activity
GO:0008283	0.758	cell population proliferation
GO:0050896	0.724	response to stimulus
GO:0051179	0.696	localization
GO:0061351	0.696	neural precursor cell proliferation
GO:0009653	0.694	anatomical structure morphogenesis
GO:0007010	0.594	cytoskeleton organization
GO:0030154	0.592	cell differentiation
GO:0030335	0.587	positive regulation of cell migration
GO:0080090	0.538	regulation of primary metabolic process
GO:0060255	0.537	regulation of macromolecule metabolic process
GO:0048468	0.528	cell development
GO:0007417	0.528	central nervous system development
GO:0031323	0.514	regulation of cellular metabolic process
GO:0051171	0.507	regulation of nitrogen compound metabolic process
GO:0051239	0.491	regulation of multicellular organismal process
GO:0048519	0.475	negative regulation of biological process
GO:0051716	0.443	cellular response to stimulus
GO:0043547	0.409	positive regulation of GTPase activity
GO:0009966	0.398	regulation of signal transduction
GO:1902531	0.382	regulation of intracellular signal transduction
GO:0022008	0.378	neurogenesis
GO:0009893	0.364	positive regulation of metabolic process
GO:0007017	0.329	microtubule-based process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0110165	0.999	cellular anatomical entity
GO:0030054	0.981	cell junction
GO:0005829	0.972	cytosol
GO:0016020	0.862	membrane
GO:0043226	0.830	organelle
GO:0043227	0.792	membrane-bounded organelle
GO:0043231	0.740	intracellular membrane-bounded organelle
GO:0005634	0.303	nucleus
GO:0045202	0.302	synapse

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]