StarFunc result for job id Q96NA2

User Input

>input (401 residues)
MEPRRAAPGVPGWGSREAAGSASAAELVYHLAGALGTELQDLARRFGPEAAAGLVPLVVR
ALELLEQAAVGPAPDSLQVSAQPAEQELRRLREENERLRRELRAGPQEERALLRQLKEVT
DRQRDELRAHNRDLRQRGQETEALQEQLQRLLLVNAELRHKLAAMQTQLRAAQDRERERQ
QPGEAATPQAKERARGQAGRPGHQHGQEPEWATAGAGAPGNPEDPAEAAQQLGRPSEAGQ
CRFSREEFEQILQERNELKAKVFLLKEELAYFQRELLTDHRVPGLLLEAMKVAVRKQRKK
IKAKMLGTPEEAESSEDEAGPWILLSDDKGDHPPPPESKIQSFFGLWYRGKAESSEDETS
SPAPSKLGGEEEAQPQSPAPDPPCSALHEHLCLGASAAPEA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q96NA2	1.000	1.000	7.649E-53	401	1.000	1.000	Q96NA2.pdb.gz	RILP_HUMAN Rab-interacting lysosomal protein OS=Homo sapiens OX=9606 GN=RILP PE=1 SV=1
2	AFDB:Q5ND29	0.461	0.482	3.340E-34	369	0.683	0.743	Q5ND29.pdb.gz	RILP_MOUSE Rab-interacting lysosomal protein OS=Mus musculus OX=10090 GN=Rilp PE=1 SV=1
3	AFDB:Q68UI8	0.202	0.141	9.938E-3	603	0.165	0.109	Q68UI8.pdb.gz	CCD61_CHLRE Variable flagella 3 OS=Chlamydomonas reinhardtii OX=3055 GN=VFL3 PE=1 SV=1
4	AFDB:Q9ESN9	0.126	0.052	9.938E-3	1337	0.185	0.055	Q9ESN9.pdb.gz	JIP3_MOUSE C-Jun-amino-terminal kinase-interacting protein 3 OS=Mus musculus OX=10090 GN=Mapk8ip3 PE=1 SV=1
5	AFDB:E9QGL9	0.138	0.053	1.433E-2	1313	0.249	0.076	E9QGL9.pdb.gz
6	AFDB:Q9GQF1	0.156	0.064	3.582E-2	1227	0.234	0.077	Q9GQF1.pdb.gz	JIP3_DROME JNK-interacting protein 3 OS=Drosophila melanogaster OX=7227 GN=syd PE=1 SV=1
7	AFDB:A0A0G2K6E8	0.146	0.062	3.807E-2	1352	0.182	0.054	A0A0G2K6E8.pdb.gz	A0A0G2K6E8_RAT Sperm associated antigen 9 OS=Rattus norvegicus OX=10116 GN=Spag9 PE=1 SV=1
8	AFDB:Q32PN7	0.177	0.103	1.143E-1	756	0.140	0.074	Q32PN7.pdb.gz	DZI1L_DANRE Cilium assembly protein DZIP1L OS=Danio rerio OX=7955 GN=dzip1l PE=2 SV=1
9	AFDB:O13791	0.220	0.205	1.648E-1	433	0.160	0.148	O13791.pdb.gz	SLT1_SCHPO Protein slt1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=slt1 PE=1 SV=3
10	AFDB:O74689	0.235	0.167	1.979E-1	586	0.195	0.133	O74689.pdb.gz	NDE1_EMENI Nuclear distribution protein nudE OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=nudE PE=1 SV=1
11	PDB:7qsmZ	0.086	0.235	3.118	142	0.047	0.134	7qsmZ.pdb.gz	Cryo-EM structures define ubiquinone-10 binding to mitochondrial complex I and conformational transitions accompanying Q-site occupancy.
12	PDB:7sqcO1	0.200	0.127	5.742	673	0.127	0.076	7sqcO1.pdb.gz	Ciliary central apparatus structure reveals mechanisms of microtubule patterning.
13	PDB:5ze9F	0.092	0.081	6.104	456	0.027	0.024	5ze9F.pdb.gz	Metastable asymmetrical structure of a shaftless V1motor.
14	PDB:7u4tE	0.090	0.079	6.488	468	0.025	0.021	7u4tE.pdb.gz	Identification of mEAK-7 as a human V-ATPase regulator via cryo-EM data mining.
15	PDB:2rvqC	0.089	0.190	7.792	133	0.047	0.143	2rvqC.pdb.gz
16	PDB:4ytpD	0.093	0.288	8.804	102	0.032	0.127	4ytpD.pdb.gz	Structural Insights into the Molecular Design of Flutolanil Derivatives Targeted for Fumarate Respiration of Parasite Mitochondria
17	PDB:6xywBD	0.092	0.147	8.804	210	0.045	0.086	6xywBD.pdb.gz	Cryo-EM structure of the RNA-rich plant mitochondrial ribosome.
18	PDB:5x3xQ	0.097	0.144	9.358	243	0.057	0.095	5x3xQ.pdb.gz
19	PDB:2jmhA	0.090	0.244	9.947	117	0.022	0.077	2jmhA.pdb.gz
20	PDB:5n61Q	0.094	0.096	9.947	389	0.052	0.054	5n61Q.pdb.gz	Structural Basis of RNA Polymerase I Transcription Initiation.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q96NA2	0.0	783	401	1.000	1.000	RILP_HUMAN Rab-interacting lysosomal protein OS=Homo sapiens OX=9606 GN=RILP PE=1 SV=1
2	Q5ND29	6.92e-163	463	369	0.693	0.753	RILP_MOUSE Rab-interacting lysosomal protein OS=Mus musculus OX=10090 GN=Rilp PE=1 SV=1
3	A0A1B0GVV3	6.67e-28	115	386	0.249	0.259	A0A1B0GVV3_HUMAN Rab interacting lysosomal protein like 1 OS=Homo sapiens OX=9606 GN=RILPL1 PE=1 SV=1
4	Q5EBL4	7.57e-28	115	403	0.249	0.248	RIPL1_HUMAN RILP-like protein 1 OS=Homo sapiens OX=9606 GN=RILPL1 PE=1 SV=1
5	D3ZUQ0	8.64e-27	112	406	0.277	0.273	RIPL1_RAT RILP-like protein 1 OS=Rattus norvegicus OX=10116 GN=Rilpl1 PE=1 SV=1
6	Q9JJC6	1.04e-26	112	406	0.252	0.249	RIPL1_MOUSE RILP-like protein 1 OS=Mus musculus OX=10090 GN=Rilpl1 PE=1 SV=1
7	O76878	3.30e-06	51.2	443	0.177	0.160	RIPL_DROME RILP-like protein homolog OS=Drosophila melanogaster OX=7227 GN=Rilpl PE=1 SV=1
8	L7RKJ8	4.00e-04	45.1	1299	0.097	0.030	L7RKJ8_DANRE C-Jun-amino-terminal kinase-interacting protein 3 OS=Danio rerio OX=7955 GN=mapk8ip3 PE=2 SV=1
9	Q9UPT6	4.98e-04	45.1	1336	0.127	0.038	JIP3_HUMAN C-Jun-amino-terminal kinase-interacting protein 3 OS=Homo sapiens OX=9606 GN=MAPK8IP3 PE=1 SV=3
10	P34609	7.56e-04	44.3	1190	0.087	0.029	JIP_CAEEL JNK-interacting protein OS=Caenorhabditis elegans OX=6239 GN=unc-16 PE=1 SV=4
11	E9PSK7	0.001	43.5	1322	0.125	0.038	JIP3_RAT C-Jun-amino-terminal kinase-interacting protein 3 OS=Rattus norvegicus OX=10116 GN=Mapk8ip3 PE=1 SV=2
12	Q8IDX6	0.001	43.9	3130	0.090	0.012	RH2A_PLAF7 Reticulocyte-binding protein homolog 2a OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=RH2a PE=1 SV=1
13	Q9ESN9	0.001	43.5	1337	0.125	0.037	JIP3_MOUSE C-Jun-amino-terminal kinase-interacting protein 3 OS=Mus musculus OX=10090 GN=Mapk8ip3 PE=1 SV=1
14	A0A8I5ZJK4	0.003	42.4	1334	0.097	0.029	A0A8I5ZJK4_RAT Sperm associated antigen 9 OS=Rattus norvegicus OX=10116 GN=Spag9 PE=1 SV=1
15	A0A8I6B3N0	0.003	42.4	1321	0.097	0.030	A0A8I6B3N0_RAT Sperm associated antigen 9 OS=Rattus norvegicus OX=10116 GN=Spag9 PE=1 SV=1
16	O60271	0.003	42.4	1321	0.097	0.030	JIP4_HUMAN C-Jun-amino-terminal kinase-interacting protein 4 OS=Homo sapiens OX=9606 GN=SPAG9 PE=1 SV=4
17	Q58A65	0.003	42.4	1321	0.097	0.030	JIP4_MOUSE C-Jun-amino-terminal kinase-interacting protein 4 OS=Mus musculus OX=10090 GN=Spag9 PE=1 SV=2
18	A0A0G2K6E8	0.004	42.0	1352	0.097	0.029	A0A0G2K6E8_RAT Sperm associated antigen 9 OS=Rattus norvegicus OX=10116 GN=Spag9 PE=1 SV=1
19	A0A8I6AXC7	0.004	42.0	1305	0.097	0.030	A0A8I6AXC7_RAT Sperm associated antigen 9 OS=Rattus norvegicus OX=10116 GN=Spag9 PE=1 SV=1
20	E9PSJ4	0.004	42.0	1324	0.097	0.029	E9PSJ4_RAT Sperm associated antigen 9 OS=Rattus norvegicus OX=10116 GN=Spag9 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF09744 Jnk-SapK_ap_N	2.5e-09	49.1	JNK_SAPK-associated protein-1
2	PF09726 Macoilin	1.1e+02	12.8	Macoilin family
3	PF20478 P2RX7_C	35	15.7	P2X purinoreceptor 7 intracellular domain
4	PF11461 RILP	1.2e-16	72.4	Rab interacting lysosomal protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000301336

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000265062	0.999	Ras-related protein Rab-7a
2	9606.ENSP00000479762	0.997	Ras-related protein Rab-7b
3	9606.ENSP00000413156	0.936	Ras-related protein Rab-34
4	9606.ENSP00000320291	0.907	Oxysterol-binding protein-related protein 1
5	9606.ENSP00000273130	0.866	Cytoplasmic dynein 1 light intermediate chain 1
6	9606.ENSP00000258198	0.829	Cytoplasmic dynein 1 light intermediate chain 2
7	9606.ENSP00000348965	0.805	Cytoplasmic dynein 1 heavy chain 1
8	9606.ENSP00000320130	0.800	Cytoplasmic dynein 1 intermediate chain 1
9	9606.ENSP00000380308	0.800	Cytoplasmic dynein 1 intermediate chain 2
10	9606.ENSP00000381167	0.800	Cytoplasmic dynein 2 heavy chain 1
11	9606.ENSP00000354791	0.683	Dynactin subunit 1
12	9606.ENSP00000296137	0.612	FYVE and coiled-coil domain-containing protein 1
13	9606.ENSP00000333326	0.609	Tubulin alpha-8 chain
14	9606.ENSP00000384136	0.608	Radixin
15	9606.ENSP00000263116	0.607	Ras-related protein Rab-36
16	9606.ENSP00000353408	0.603	Moesin
17	9606.ENSP00000217133	0.600	Tubulin beta-1 chain
18	9606.ENSP00000248437	0.600	Tubulin alpha-4A chain
19	9606.ENSP00000259818	0.600	Tubulin beta-2B chain
20	9606.ENSP00000264071	0.600	Tubulin beta-4A chain

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0019899	0.983	enzyme binding
GO:0031267	0.948	small GTPase binding
GO:0051959	0.682	dynein light intermediate chain binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0016050	0.993	vesicle organization
GO:0010256	0.988	endomembrane system organization
GO:0016197	0.986	endosomal transport
GO:0007032	0.984	endosome organization
GO:0071985	0.975	multivesicular body sorting pathway
GO:0016482	0.972	cytosolic transport
GO:0007041	0.969	lysosomal transport
GO:0065007	0.965	biological regulation
GO:0050789	0.956	regulation of biological process
GO:0008333	0.952	endosome to lysosome transport
GO:0048518	0.939	positive regulation of biological process
GO:0032509	0.841	endosome transport via multivesicular body sorting pathway
GO:0061024	0.735	membrane organization
GO:0019222	0.678	regulation of metabolic process
GO:0009893	0.650	positive regulation of metabolic process
GO:0050794	0.509	regulation of cellular process
GO:0009896	0.508	positive regulation of catabolic process
GO:0010604	0.468	positive regulation of macromolecule metabolic process
GO:0042176	0.467	regulation of protein catabolic process
GO:0065008	0.444	regulation of biological quality
GO:0048519	0.435	negative regulation of biological process
GO:0045732	0.433	positive regulation of protein catabolic process
GO:0006900	0.428	vesicle budding from membrane
GO:0042177	0.331	negative regulation of protein catabolic process
GO:0090066	0.301	regulation of anatomical structure size

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	1.000	membrane
GO:0012505	1.000	endomembrane system
GO:0005737	1.000	cytoplasm
GO:0043231	1.000	intracellular membrane-bounded organelle
GO:0031982	0.989	vesicle
GO:0000323	0.976	lytic vacuole
GO:0031090	0.971	organelle membrane
GO:0005764	0.968	lysosome
GO:0098588	0.960	bounding membrane of organelle
GO:0031410	0.945	cytoplasmic vesicle
GO:0005768	0.931	endosome
GO:0005774	0.876	vacuolar membrane
GO:0043232	0.869	intracellular non-membrane-bounded organelle
GO:0005770	0.849	late endosome
GO:0098852	0.811	lytic vacuole membrane
GO:0005765	0.781	lysosomal membrane
GO:0032991	0.770	protein-containing complex
GO:0005856	0.666	cytoskeleton
GO:0005829	0.489	cytosol
GO:0010008	0.410	endosome membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]