StarFunc result for job id Q96NB3

User Input

>input (372 residues)
MASSASARTPAGKRVINQEELRRLMKEKQRLSTSRKRIESPFAKYNRLGQLSCALCNTPV
KSELLWQTHVLGKQHREKVAELKGAKEASQGSSASSAPHSVKRKAPDADDQDVKRAKATL
VPQVQPSTSAWTTNFDKIGKEFIRATPSKPSGLSLLPDYEDEEEEEEEEEGDGERKRGDA
SKPLSDAQGKEHSVSSSREVTSSVLPNDFFSTNPPKAPIIPHSGSIEKAEIHEKVVERRE
NTAEALPEGFFDDPEVDARVRKVDAPKDQMDKEWDEFQKAMRQVNTISEAIVAEEDEEGR
LDRQIGEIDEQIECYRRVEKLRNRQDEIKNKLKEILTIKELQKKEEENADSDDEGELQDL
LSQDWRVKGALL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q96NB3	1.000	1.000	3.422E-54	372	1.000	1.000	Q96NB3.pdb.gz	ZN830_HUMAN Zinc finger protein 830 OS=Homo sapiens OX=9606 GN=ZNF830 PE=1 SV=2
2	AFDB:Q8R1N0	0.559	0.572	1.581E-42	363	0.833	0.854	Q8R1N0.pdb.gz	ZN830_MOUSE Zinc finger protein 830 OS=Mus musculus OX=10090 GN=Znf830 PE=1 SV=1
3	AFDB:Q9M8S7	0.199	0.232	8.878E-9	313	0.177	0.211	Q9M8S7.pdb.gz	ARS1_ARATH Protein ABA AND ROS SENSITIVE 1 OS=Arabidopsis thaliana OX=3702 GN=ARS1 PE=1 SV=1
4	PDB:5gm6I	0.143	0.445	3.237E-3	102	0.056	0.206	5gm6I.pdb.gz	Structure of a yeast activated spliceosome at 3.5 angstrom resolution
5	PDB:6ff47	0.138	0.450	4.828E-3	93	0.075	0.301	6ff47.pdb.gz	Structure and Conformational Dynamics of the Human Spliceosomal BactComplex.
6	PDB:5z56v	0.124	0.263	7.201E-3	167	0.059	0.132	5z56v.pdb.gz	Structure of the human activated spliceosome in three conformational states.
7	AFDB:P38280	0.178	0.119	7.620E-3	609	0.126	0.077	P38280.pdb.gz	YSW1_YEAST Spore-specific protein YSW1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YSW1 PE=1 SV=1
8	PDB:7dvqv	0.127	0.352	8.795E-3	119	0.035	0.109	7dvqv.pdb.gz	Structure of the activated human minor spliceosome.
9	PDB:7abiF	0.119	0.250	1.402E-2	165	0.062	0.139	7abiF.pdb.gz	Mechanism of protein-guided folding of the active site U2/U6 RNA during spliceosome activation.
10	PDB:6g90U	0.138	0.257	2.236E-2	196	0.048	0.092	6g90U.pdb.gz	Prespliceosome structure provides insights into spliceosome assembly and regulation.
11	PDB:5zwmv	0.138	0.290	3.335E-2	174	0.051	0.109	5zwmv.pdb.gz	Structures of the fully assembledSaccharomyces cerevisiaespliceosome before activation
12	PDB:5nrlU	0.135	0.252	4.354E-2	196	0.046	0.087	5nrlU.pdb.gz	Structure of a pre-catalytic spliceosome.
13	AFDB:A6MCV0	0.085	0.066	5.627E-2	513	0.086	0.062	A6MCV0.pdb.gz	A6MCV0_CHICK Microcephalin OS=Gallus gallus OX=9031 GN=MCPH1 PE=2 SV=1
14	AFDB:Q582C1	0.190	0.076	5.627E-2	1177	0.183	0.058	Q582C1.pdb.gz	Q582C1_TRYB2 WW domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb05.3C6.560 PE=4 SV=1
15	AFDB:Q6PJH3	0.149	0.172	1.171E-1	314	0.124	0.146	Q6PJH3.pdb.gz	Q6PJH3_HUMAN A kinase (PRKA) anchor protein (Yotiao) 9, isoform CRA_c OS=Homo sapiens OX=9606 GN=AKAP9 PE=1 SV=1
16	AFDB:Q3UPA6	0.129	0.053	3.183E-1	1018	0.169	0.062	Q3UPA6.pdb.gz	Q3UPA6_MOUSE Bromodomain PHD finger transcription factor (Fragment) OS=Mus musculus OX=10090 GN=Bptf PE=2 SV=1
17	AFDB:Q7TQE6	0.198	0.127	3.402E-1	664	0.159	0.089	Q7TQE6.pdb.gz	MACOI_MOUSE Macoilin OS=Mus musculus OX=10090 GN=Maco1 PE=1 SV=1
18	AFDB:Q9N360	0.101	0.064	3.402E-1	662	0.099	0.056	Q9N360.pdb.gz	Q9N360_CAEEL C2H2-type domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=znf-782 PE=1 SV=1
19	PDB:6qx91C	0.108	0.726	4.487E-1	50	0.030	0.220	6qx91C.pdb.gz	Mechanism of 5' splice site transfer for human spliceosome activation.
20	PDB:6g90T	0.099	0.081	1.067	462	0.035	0.028	6g90T.pdb.gz	Prespliceosome structure provides insights into spliceosome assembly and regulation.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8R1N0	0.0	602	363	0.828	0.848	ZN830_MOUSE Zinc finger protein 830 OS=Mus musculus OX=10090 GN=Znf830 PE=1 SV=1
2	Q96NB3	0.0	755	372	1.000	1.000	ZN830_HUMAN Zinc finger protein 830 OS=Homo sapiens OX=9606 GN=ZNF830 PE=1 SV=2
3	Q9M8S7	7.22e-08	55.8	313	0.156	0.185	ARS1_ARATH Protein ABA AND ROS SENSITIVE 1 OS=Arabidopsis thaliana OX=3702 GN=ARS1 PE=1 SV=1
4	Q9C911	0.003	42.0	630	0.046	0.027	JJJ1_ARATH DNAJ protein JJJ1 homolog OS=Arabidopsis thaliana OX=3702 GN=JJJ1 PE=1 SV=1
5	Q9VU15	0.016	38.9	264	0.073	0.102	Q9VU15_DROME LD47455p OS=Drosophila melanogaster OX=7227 GN=Sf3a2 PE=1 SV=1
6	Q9P7L8	0.086	36.6	217	0.059	0.101	SAP62_SCHPO Pre-mRNA-splicing factor sap62 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=sap62 PE=1 SV=1
7	Q08004	0.099	35.8	166	0.043	0.096	BUD20_YEAST Bud site selection protein 20 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=BUD20 PE=1 SV=1
8	Q6DIC6	0.12	37.0	2087	0.059	0.011	Q6DIC6_MOUSE Tro protein OS=Mus musculus OX=10090 GN=Tro PE=1 SV=1
9	Q99PB3	0.16	36.6	1987	0.059	0.011	Q99PB3_MOUSE Mage-d3 OS=Mus musculus OX=10090 GN=Tro PE=2 SV=1
10	A0A178VXZ1	0.34	35.0	277	0.056	0.076	A0A178VXZ1_ARATH Matrin-type domain-containing protein OS=Arabidopsis thaliana OX=3702 GN=At2g32600 PE=1 SV=1
11	Q9HA38	0.42	34.7	289	0.035	0.045	ZMAT3_HUMAN Zinc finger matrin-type protein 3 OS=Homo sapiens OX=9606 GN=ZMAT3 PE=1 SV=1
12	A2AFN3	0.47	35.0	560	0.056	0.037	A2AFN3_MOUSE Trophinin (Fragment) OS=Mus musculus OX=10090 GN=Tro PE=1 SV=8
13	O08781	0.76	33.9	289	0.035	0.045	ZMAT3_RAT Zinc finger matrin-type protein 3 OS=Rattus norvegicus OX=10116 GN=Zmat3 PE=2 SV=1
14	O54836	0.76	33.9	290	0.035	0.045	ZMAT3_MOUSE Zinc finger matrin-type protein 3 OS=Mus musculus OX=10090 GN=Zmat3 PE=2 SV=1
15	Q501L8	0.82	34.3	863	0.040	0.017	Q501L8_MOUSE Scaper protein (Fragment) OS=Mus musculus OX=10090 GN=Scaper PE=2 SV=1
16	Q19335	1.0	33.1	222	0.070	0.117	Q19335_CAEEL Matrin-type domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=repo-1 PE=1 SV=2
17	Q69ZJ3	1.2	33.9	1393	0.032	0.009	Q69ZJ3_MOUSE MKIAA1454 protein (Fragment) OS=Mus musculus OX=10090 GN=Scaper PE=2 SV=1
18	Q99NC2	1.2	33.9	804	0.056	0.026	Q99NC2_MOUSE MAGE-necdin/trophinin complex (Magphinin) OS=Mus musculus OX=10090 GN=Tro PE=2 SV=1
19	B2RXS3	1.3	33.9	1392	0.032	0.009	B2RXS3_MOUSE S phase cyclin A-associated protein in the ER OS=Mus musculus OX=10090 GN=Scaper PE=1 SV=1
20	F8VQ70	1.3	33.9	1398	0.032	0.009	F8VQ70_MOUSE S phase cyclin A-associated protein in the ER OS=Mus musculus OX=10090 GN=Scaper PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF06676 DUF1178	2.3e+02	13.6	Protein of unknown function (DUF1178)
2	PF04136 Sec34	69	14.8	Sec34-like family
3	PF12756 zf-C2H2_2	5.5e+02	12.3	C2H2 type zinc-finger (2 copies)
4	PF12171 zf-C2H2_jaz	1.4	20.5	Zinc-finger double-stranded RNA-binding
5	PF12874 zf-met	0.58	21.8	Zinc-finger of C2H2 type

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000354518

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000361918	0.988	Peptidyl-prolyl cis-trans isomerase E
2	9606.ENSP00000156471	0.986	Intron-binding protein aquarius
3	9606.ENSP00000227524	0.975	Pre-mRNA-processing factor 19
4	9606.ENSP00000351137	0.960	Pre-mRNA-splicing factor SYF1
5	9606.ENSP00000262809	0.900	RNA polymerase II elongation factor ELL
6	9606.ENSP00000215793	0.899	Splicing factor 3A subunit 1
7	9606.ENSP00000334553	0.870	Peptidyl-prolyl cis-trans isomerase-like 2
8	9606.ENSP00000261531	0.830	SNW domain-containing protein 1
9	9606.ENSP00000254803	0.763	Something about silencing protein 10
10	9606.ENSP00000329858	0.760	tRNA wybutosine-synthesizing protein 2 homolog
11	9606.ENSP00000326411	0.732	CWF19-like protein 1
12	9606.ENSP00000432279	0.725	Charged multivesicular body protein 1b
13	9606.ENSP00000252445	0.715	Transcription elongation factor 1 homolog
14	9606.ENSP00000362110	0.695	Splicing factor 3A subunit 3
15	9606.ENSP00000415436	0.692	KAT8 regulatory NSL complex subunit 2
16	9606.ENSP00000366557	0.690	Crooked neck-like protein 1
17	9606.ENSP00000364270	0.689	DNA repair protein complementing XP-A cells
18	9606.ENSP00000221494	0.681	Splicing factor 3A subunit 2
19	9606.ENSP00000286175	0.674	Peptidyl-prolyl cis-trans isomerase
20	9606.ENSP00000285398	0.663	TFIIH basal transcription factor complex helicase XPB subunit

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0044238	0.990	primary metabolic process
GO:0006807	0.988	nitrogen compound metabolic process
GO:0044237	0.988	cellular metabolic process
GO:0043170	0.985	macromolecule metabolic process
GO:0006974	0.983	cellular response to DNA damage stimulus
GO:0090304	0.983	nucleic acid metabolic process
GO:0000075	0.977	cell cycle checkpoint signaling
GO:0000278	0.974	mitotic cell cycle
GO:1901990	0.953	regulation of mitotic cell cycle phase transition
GO:0044260	0.944	cellular macromolecule metabolic process
GO:0051171	0.938	regulation of nitrogen compound metabolic process
GO:1903047	0.936	mitotic cell cycle process
GO:0032502	0.930	developmental process
GO:0080090	0.930	regulation of primary metabolic process
GO:0060255	0.929	regulation of macromolecule metabolic process
GO:0031323	0.929	regulation of cellular metabolic process
GO:0031570	0.920	DNA integrity checkpoint signaling
GO:0007093	0.918	mitotic cell cycle checkpoint signaling
GO:0032501	0.895	multicellular organismal process
GO:0010389	0.887	regulation of G2/M transition of mitotic cell cycle
GO:0000003	0.878	reproduction
GO:0042770	0.878	signal transduction in response to DNA damage
GO:0044774	0.870	mitotic DNA integrity checkpoint signaling
GO:1902750	0.863	negative regulation of cell cycle G2/M phase transition
GO:1901991	0.849	negative regulation of mitotic cell cycle phase transition
GO:0044818	0.813	mitotic G2/M transition checkpoint
GO:0071840	0.803	cellular component organization or biogenesis
GO:0019219	0.783	regulation of nucleobase-containing compound metabolic process
GO:0006259	0.769	DNA metabolic process
GO:0016043	0.722	cellular component organization
GO:0048856	0.568	anatomical structure development
GO:0007275	0.519	multicellular organism development
GO:0000077	0.516	DNA damage checkpoint signaling
GO:0044773	0.425	mitotic DNA damage checkpoint signaling
GO:0000076	0.420	DNA replication checkpoint signaling
GO:0010605	0.412	negative regulation of macromolecule metabolic process
GO:0022414	0.410	reproductive process
GO:0016070	0.408	RNA metabolic process
GO:0060729	0.405	intestinal epithelial structure maintenance
GO:0051172	0.396	negative regulation of nitrogen compound metabolic process
GO:2000104	0.388	negative regulation of DNA-templated DNA replication
GO:0010467	0.368	gene expression
GO:0001541	0.343	ovarian follicle development
GO:0045005	0.334	DNA-templated DNA replication maintenance of fidelity
GO:0033260	0.333	nuclear DNA replication
GO:0051276	0.329	chromosome organization
GO:0022602	0.327	ovulation cycle process
GO:0010941	0.324	regulation of cell death
GO:0022412	0.320	cellular process involved in reproduction in multicellular organism
GO:0048589	0.318	developmental growth
GO:0030154	0.315	cell differentiation
GO:0043009	0.315	chordate embryonic development
GO:0042981	0.308	regulation of apoptotic process
GO:0048468	0.305	cell development
GO:0007276	0.302	gamete generation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0016604	0.639	nuclear body
GO:0032991	0.467	protein-containing complex
GO:0005737	0.454	cytoplasm
GO:0016607	0.324	nuclear speck

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]