StarFunc result for job id Q96NH3

User Input

>input (1257 residues)
MAHFSSEDQAMLQAMLRRLFQSVKEKITGAPSLECAEEILLHLEETDENFHNYEFVKYLR
QHIGNTLGSMIEEEMEKCTSDRNQGEECGYDTVVQQVTKRTQESKEYKEMMHYLKNIMIA
VVESMINKFEEDETRNQERQKKIQKEKSHSYRTDNCSDSDSSLNQSYKFCQGKLQLILDQ
LDPGQPKEVRYEALQTLCSAPPSDVLNCENWTTLCEKLTVSLSDPDPVFSDRILKFCAQT
FLLSPLHMTKEIYTSLAKYLESYFLSRENHIPTLSAGVDITNPNMTRLLKKVRLLNEYQK
EAPSFWIRHPEKYMEEIVESTLSLLTVKHNQSHVVSQKILDPIYFFALVDTKAVWFKKWM
HAHYSRTTVLRLLETKYKSLVTTAIQQCVQYFEMCKTRKADETLGHSKHCRNKQKTFYYL
GQELQYIYFIHSLCLLGRLLIYKQGRKLFPIKLKNKKGLVSLIDLLVLFTQLIYYSPSCP
KMTSAAHSENYSPASMVTEVLWILSDQKECAVECLYNNIVIETLLQPIHNLMKGNEASPN
CSETALIHIAGILARIASVEEGLILLLYGANMNSSEESPTGAHIIAQFSKKLLDEDISIF
SGSEMLPVVKGAFISVCRHIYSTCEGLQVLITYNLHESIAKAWKKTSLLSERIPTPVEGS
DSVSSVSQESQNIMAWEDNLLDDLLHFAATPKGLLLLQRTGAINECVTFIFNRYAKKLQV
SRHKKFGYGVLVTRVASTAAGGIALKKSGFINELITELWSNLEYGRDDVRVTHPRTTPVD
PIDRSCQKSFLALVNLLSYPAIYELVRNQDLPNKTEYSLREVPTCVIDIIDRLIILNSEA
KIRSLFNYEQSHIFGLRDFIIDGLSVERNHVLVRINLVGGPLERILPPRLLEKSDNPYPW
PMFSSYPLPNCYLSDITRNAGIKQDNDLDKLLLCLKISDKQTEWIENCQRQFCKMMKAKP
DIISGEALIELLEKFVLHLTESPSECYFPSVEYTATDANVKNESLSSVQQLGIKMTVRYG
KFLSLLKDGAENDLTWVLKHCERFLKQQQTSIKSSLLCLQGNYAGHDWFVSSLFMIMLGD
KEKTFQFLHQFSRLLTSAFLWLPRLHISSYLPNDTVESGIHPVYFCSTHYIEMLLKAELP
LVFSAFHMSGFAPSQICLQWITQCFWNYLDWIEICHYIATCVFLGPDYQVYICIAVFKHL
QQDILQHTQTQDLQVFLKEEALHGFRVSDYFEYMEILEQNYRTVLLRDMRNIRLQST

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q3URV1	0.871	0.845	0.000	1296	0.843	0.818	Q3URV1.pdb.gz	BROMI_MOUSE Protein broad-minded OS=Mus musculus OX=10090 GN=Tbc1d32 PE=1 SV=2
2	AFDB:Q96NH3	1.000	1.000	0.000	1257	1.000	1.000	Q96NH3.pdb.gz	BROMI_HUMAN Protein broad-minded OS=Homo sapiens OX=9606 GN=TBC1D32 PE=1 SV=4
3	AFDB:Q5RHR6	0.809	0.784	1.134E-103	1298	0.565	0.547	Q5RHR6.pdb.gz	BROMI_DANRE Protein broad-minded OS=Danio rerio OX=7955 GN=tbc1d32 PE=3 SV=2
4	PDB:7unkA	0.224	0.252	2.230E-5	1047	0.103	0.124	7unkA.pdb.gz
5	AFDB:O00410	0.198	0.219	2.440E-5	1097	0.103	0.118	O00410.pdb.gz	IPO5_HUMAN Importin-5 OS=Homo sapiens OX=9606 GN=IPO5 PE=1 SV=4
6	PDB:3w3uA	0.188	0.218	3.061E-5	1030	0.097	0.118	3w3uA.pdb.gz
7	PDB:3w3zA	0.173	0.202	3.314E-5	1013	0.102	0.126	3w3zA.pdb.gz	Structural basis for cell-cycle-dependent nuclear import mediated by the karyopherin Kap121p.
8	AFDB:Q8H0U3	0.158	0.201	4.246E-5	834	0.071	0.107	Q8H0U3.pdb.gz	Q8H0U3_ARATH ARM repeat superfamily protein OS=Arabidopsis thaliana OX=3702 GN=At1g23180 PE=1 SV=1
9	AFDB:Q38BV5	0.187	0.241	6.063E-5	866	0.091	0.133	Q38BV5.pdb.gz	Q38BV5_TRYB2 Importin beta-1 subunit, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.70.4720 PE=4 SV=1
10	AFDB:Q5W041	0.207	0.275	6.828E-5	872	0.080	0.116	Q5W041.pdb.gz	ARMC3_HUMAN Armadillo repeat-containing protein 3 OS=Homo sapiens OX=9606 GN=ARMC3 PE=2 SV=2
11	PDB:6xu2A	0.193	0.215	7.313E-5	1091	0.091	0.104	6xu2A.pdb.gz	X-ray Structure of the Human Karyopherin RanBP5, an Essential Factor for Influenza Polymerase Nuclear Trafficking.
12	AFDB:Q9R0L4	0.146	0.145	7.390E-5	1273	0.118	0.116	Q9R0L4.pdb.gz	CAND2_RAT Cullin-associated NEDD8-dissociated protein 2 OS=Rattus norvegicus OX=10116 GN=Cand2 PE=1 SV=1
13	PDB:3nd2A	0.159	0.197	7.609E-5	861	0.082	0.120	3nd2A.pdb.gz
14	PDB:3s4wB	0.139	0.148	1.551E-4	1146	0.112	0.123	3s4wB.pdb.gz
15	AFDB:Q19969	0.127	0.234	1.697E-4	514	0.060	0.148	Q19969.pdb.gz	IMA3_CAEEL Importin subunit alpha-3 OS=Caenorhabditis elegans OX=6239 GN=ima-3 PE=1 SV=2
16	PDB:7mqaLM	0.099	0.071	1.818E-4	2041	0.115	0.071	7mqaLM.pdb.gz	Nucleolar maturation of the human small subunit processome.
17	PDB:2z6gA	0.165	0.314	2.305E-4	550	0.058	0.133	2z6gA.pdb.gz
18	PDB:5tbkA	0.179	0.432	2.305E-4	417	0.044	0.132	5tbkA.pdb.gz
19	PDB:2q5dB	0.162	0.210	2.398E-4	845	0.076	0.114	2q5dB.pdb.gz	Molecular Basis for the Recognition of Snurportin 1 by Importin {beta}.
20	AFDB:A0A024R169	0.114	0.141	2.423E-4	929	0.089	0.121	A0A024R169.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q3URV1	0.0	2170	1296	0.847	0.822	BROMI_MOUSE Protein broad-minded OS=Mus musculus OX=10090 GN=Tbc1d32 PE=1 SV=2
2	Q5RHR6	0.0	1460	1298	0.570	0.552	BROMI_DANRE Protein broad-minded OS=Danio rerio OX=7955 GN=tbc1d32 PE=3 SV=2
3	Q96NH3	0.0	2612	1257	1.000	1.000	BROMI_HUMAN Protein broad-minded OS=Homo sapiens OX=9606 GN=TBC1D32 PE=1 SV=4
4	P82914	6.2	33.1	257	0.019	0.093	RT15_HUMAN Small ribosomal subunit protein uS15m OS=Homo sapiens OX=9606 GN=MRPS15 PE=1 SV=1
5	P37802	6.6	32.7	199	0.023	0.146	TAGL2_HUMAN Transgelin-2 OS=Homo sapiens OX=9606 GN=TAGLN2 PE=1 SV=3
6	Q9K2S2	7.2	33.5	801	0.021	0.032	MRPA_BACSU Na(+)/H(+) antiporter subunit A OS=Bacillus subtilis (strain 168) OX=224308 GN=mrpA PE=1 SV=2
7	Q8I592	9.0	33.1	803	0.014	0.022	Q8I592_PLAF7 Elongation factor G, mitochondrial OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1233000 PE=3 SV=1
8	S6F527	9.7	33.1	888	0.017	0.024	EAT17_CAEEL Rab GTPase-activating protein eat-17 OS=Caenorhabditis elegans OX=6239 GN=eat-17 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF14961 BROMI	0	2181.7	Broad-minded protein
2	PF12922 Cnd1_N	31	15.9	non-SMC mitotic condensation complex subunit 1, N-term
3	PF17514 DUF5442	3.1e+02	13.0	Family of unknown function (DUF5442)
4	PF14288 FKS1_dom1	2e+02	13.7	1,3-beta-glucan synthase subunit FKS1, domain-1
5	PF06757 Ins_allergen_rp	2.4e+02	13.0	Insect allergen related repeat, nitrile-specifier detoxification
6	PF00566 RabGAP-TBC	17	16.5	Rab-GTPase-TBC domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000381270

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000262498	0.819	Cilia- and flagella-associated protein 20
2	9606.ENSP00000330460	0.810	Probable ATP-dependent RNA helicase DDX59
3	9606.ENSP00000242505	0.776	Protein FAM149B1
4	9606.ENSP00000389014	0.716	Protein JBTS17
5	9606.ENSP00000281142	0.706	Sodium channel and clathrin linker 1
6	9606.ENSP00000322343	0.662	Cyclin-dependent kinase 20
7	9606.ENSP00000299736	0.660	Centromere protein V
8	9606.ENSP00000334379	0.623	C2 domain-containing protein 3
9	9606.ENSP00000260327	0.617	CTD small phosphatase-like protein 2
10	9606.ENSP00000379500	0.607	Ubiquitin-conjugating enzyme E2 variant 3
11	9606.ENSP00000476767	0.591	Peptidyl-prolyl cis-trans isomerase FKBP8
12	9606.ENSP00000337907	0.557	MAGUK p55 subfamily member 7
13	9606.ENSP00000248933	0.513	Seizure 6-like protein
14	9606.ENSP00000265960	0.506	Target of rapamycin complex 2 subunit MAPKAP1
15	9606.ENSP00000369409	0.504	Exocyst complex component 3 like 4

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.997	cellular process
GO:0016043	0.988	cellular component organization
GO:0065007	0.938	biological regulation
GO:0050789	0.933	regulation of biological process
GO:0050794	0.924	regulation of cellular process
GO:0060271	0.920	cilium assembly
GO:0051179	0.694	localization
GO:0051641	0.587	cellular localization
GO:0050896	0.518	response to stimulus
GO:0032502	0.508	developmental process
GO:0048856	0.503	anatomical structure development
GO:0032501	0.483	multicellular organismal process
GO:0007275	0.401	multicellular organism development
GO:0033036	0.392	macromolecule localization
GO:0023052	0.369	signaling
GO:0007154	0.356	cell communication
GO:0007165	0.348	signal transduction
GO:0008104	0.347	protein localization
GO:0033365	0.308	protein localization to organelle
GO:0007166	0.301	cell surface receptor signaling pathway

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005622	1.000	intracellular anatomical structure
GO:0043226	0.999	organelle
GO:0043227	0.987	membrane-bounded organelle
GO:0043229	0.967	intracellular organelle
GO:0043231	0.964	intracellular membrane-bounded organelle
GO:0005737	0.963	cytoplasm
GO:0032991	0.951	protein-containing complex
GO:0005634	0.763	nucleus
GO:0005829	0.342	cytosol
GO:0031981	0.302	nuclear lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]