StarFunc result for job id Q96NI6

User Input

>input (719 residues)
MEKILFYLFLIGIAVKAQICPKRCVCQILSPNLATLCAKKGLLFVPPNIDRRTVELRLAD
NFVTNIKRKDFANMTSLVDLTLSRNTISFITPHAFADLRNLRALHLNSNRLTKITNDMFS
GLSNLHHLILNNNQLTLISSTAFDDVFALEELDLSYNNLETIPWDAVEKMVSLHTLSLDH
NMIDNIPKGTFSHLHKMTRLDVTSNKLQKLPPDPLFQRAQVLATSGIISPSTFALSFGGN
PLHCNCELLWLRRLSREDDLETCASPPLLTGRYFWSIPEEEFLCEPPLITRHTHEMRVLE
GQRATLRCKARGDPEPAIHWISPEGKLISNATRSLVYDNGTLDILITTVKDTGAFTCIAS
NPAGEATQIVDLHIIKLPHLLNSTNHIHEPDPGSSDISTSTKSGSNTSSSNGDTKLSQDK
IVVAEATSSTALLKFNFQRNIPGIRMFQIQYNGTYDDTLVYRMIPPTSKTFLVNNLAAGT
MYDLCVLAIYDDGITSLTATRVVGCIQFTTEQDYVRCHFMQSQFLGGTMIIIIGGIIVAS
VLVFIIILMIRYKVCNNNGQHKVTKVSNVYSQTNGAQIQGCSVTLPQSVSKQAVGHEENA
QCCKATSDNVIQSSETCSSQDSSTTTSALPPSWTSSTSVSQKQKRKTGTKPSTEPQNEAV
TNVESQNTNRNNSTALQLASRPPDSVTEGPTSKRAHIKPNALLTNVDQIVQETQRLELI

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:D4A1J9	0.540	0.540	0.000	719	0.950	0.950	D4A1J9.pdb.gz	LRFN5_RAT Leucine-rich repeat and fibronectin type-III domain-containing protein 5 OS=Rattus norvegicus OX=10116 GN=Lrfn5 PE=1 SV=1
2	AFDB:Q9ULH4	0.541	0.494	7.247E-77	789	0.510	0.465	Q9ULH4.pdb.gz	LRFN2_HUMAN Leucine-rich repeat and fibronectin type-III domain-containing protein 2 OS=Homo sapiens OX=9606 GN=LRFN2 PE=1 SV=2
3	AFDB:Q9P244	0.515	0.481	4.598E-75	771	0.503	0.470	Q9P244.pdb.gz	LRFN1_HUMAN Leucine-rich repeat and fibronectin type III domain-containing protein 1 OS=Homo sapiens OX=9606 GN=LRFN1 PE=1 SV=2
4	AFDB:Q9BTN0	0.587	0.665	1.667E-69	628	0.419	0.479	Q9BTN0.pdb.gz	LRFN3_HUMAN Leucine-rich repeat and fibronectin type-III domain-containing protein 3 OS=Homo sapiens OX=9606 GN=LRFN3 PE=2 SV=1
5	AFDB:D4ABX8	0.592	0.660	1.232E-68	636	0.412	0.465	D4ABX8.pdb.gz	LRFN4_RAT Leucine-rich repeat and fibronectin type-III domain-containing protein 4 OS=Rattus norvegicus OX=10116 GN=Lrfn4 PE=1 SV=1
6	AFDB:Q6UXK2	0.290	0.281	7.139E-30	745	0.193	0.187	Q6UXK2.pdb.gz	ISLR2_HUMAN Immunoglobulin superfamily containing leucine-rich repeat protein 2 OS=Homo sapiens OX=9606 GN=ISLR2 PE=1 SV=1
7	AFDB:F8W4D7	0.278	0.318	4.994E-27	619	0.174	0.202	F8W4D7.pdb.gz
8	AFDB:Q5RKR3	0.322	0.314	4.994E-27	745	0.193	0.187	Q5RKR3.pdb.gz	ISLR2_MOUSE Immunoglobulin superfamily containing leucine-rich repeat protein 2 OS=Mus musculus OX=10090 GN=Islr2 PE=1 SV=1
9	AFDB:A0A286YAB9	0.253	0.285	7.087E-27	628	0.210	0.240	A0A286YAB9.pdb.gz
10	AFDB:E9QDQ3	0.338	0.293	8.656E-27	858	0.224	0.188	E9QDQ3.pdb.gz	E9QDQ3_DANRE Leucine-rich repeat-containing 4.1 OS=Danio rerio OX=7955 GN=lrrc4.1 PE=4 SV=2
11	PDB:5y31B	0.168	0.220	1.555E-9	511	0.108	0.153	5y31B.pdb.gz	Structural basis of epilepsy-related ligand-receptor complex LGI1-ADAM22.
12	PDB:1xcdA	0.232	0.480	1.806E-9	305	0.096	0.226	1xcdA.pdb.gz
13	PDB:5oj2B	0.118	0.123	1.270E-8	692	0.047	0.049	5oj2B.pdb.gz
14	PDB:6dldD	0.112	0.292	2.093E-8	269	0.058	0.156	6dldD.pdb.gz
15	PDB:2ft3F	0.249	0.526	3.283E-8	305	0.097	0.230	2ft3F.pdb.gz
16	PDB:5yq5B	0.259	0.572	3.451E-8	306	0.099	0.232	5yq5B.pdb.gz
17	PDB:6gffI	0.135	0.168	1.547E-7	551	0.095	0.123	6gffI.pdb.gz
18	PDB:7wrqA	0.246	0.305	1.710E-7	566	0.081	0.102	7wrqA.pdb.gz
19	PDB:7tvfD	0.210	0.274	3.275E-7	515	0.082	0.115	7tvfD.pdb.gz	Structure of the SHOC2-MRAS-PP1C complex provides insights into RAF activation and Noonan syndrome.
20	PDB:3o3uN	0.108	0.132	3.620E-7	580	0.045	0.055	3o3uN.pdb.gz	The 1.5 A crystal structure of human receptor for advanced glycation endproducts (RAGE) ectodomains reveals unique features determining ligand binding.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	B0BNK7	0.0	597	626	0.423	0.486	LRFN3_RAT Leucine-rich repeat and fibronectin type-III domain-containing protein 3 OS=Rattus norvegicus OX=10116 GN=Lrfn3 PE=1 SV=1
2	D4A1J9	0.0	1439	719	0.962	0.962	LRFN5_RAT Leucine-rich repeat and fibronectin type-III domain-containing protein 5 OS=Rattus norvegicus OX=10116 GN=Lrfn5 PE=1 SV=1
3	D4ABX8	0.0	603	636	0.402	0.454	LRFN4_RAT Leucine-rich repeat and fibronectin type-III domain-containing protein 4 OS=Rattus norvegicus OX=10116 GN=Lrfn4 PE=1 SV=1
4	P0C7J6	0.0	706	766	0.473	0.444	LRFN1_RAT Leucine-rich repeat and fibronectin type III domain-containing protein 1 OS=Rattus norvegicus OX=10116 GN=Lrfn1 PE=1 SV=1
5	Q2WF71	0.0	708	766	0.476	0.446	LRFN1_MOUSE Leucine-rich repeat and fibronectin type III domain-containing protein 1 OS=Mus musculus OX=10090 GN=Lrfn1 PE=1 SV=1
6	Q460M5	0.0	680	788	0.490	0.447	LRFN2_RAT Leucine-rich repeat and fibronectin type-III domain-containing protein 2 OS=Rattus norvegicus OX=10116 GN=Lrfn2 PE=1 SV=1
7	Q6PJG9	0.0	604	635	0.403	0.457	LRFN4_HUMAN Leucine-rich repeat and fibronectin type-III domain-containing protein 4 OS=Homo sapiens OX=9606 GN=LRFN4 PE=1 SV=1
8	Q80TG9	0.0	681	788	0.490	0.447	LRFN2_MOUSE Leucine-rich repeat and fibronectin type-III domain-containing protein 2 OS=Mus musculus OX=10090 GN=Lrfn2 PE=1 SV=2
9	Q80XU8	0.0	604	636	0.402	0.454	LRFN4_MOUSE Leucine-rich repeat and fibronectin type-III domain-containing protein 4 OS=Mus musculus OX=10090 GN=Lrfn4 PE=1 SV=1
10	Q8BLY3	0.0	598	626	0.423	0.486	LRFN3_MOUSE Leucine-rich repeat and fibronectin type-III domain-containing protein 3 OS=Mus musculus OX=10090 GN=Lrfn3 PE=1 SV=1
11	Q8BXA0	0.0	1445	719	0.968	0.968	LRFN5_MOUSE Leucine-rich repeat and fibronectin type-III domain-containing protein 5 OS=Mus musculus OX=10090 GN=Lrfn5 PE=1 SV=1
12	Q96NI6	0.0	1488	719	1.000	1.000	LRFN5_HUMAN Leucine-rich repeat and fibronectin type-III domain-containing protein 5 OS=Homo sapiens OX=9606 GN=LRFN5 PE=1 SV=2
13	Q9BTN0	0.0	597	628	0.423	0.484	LRFN3_HUMAN Leucine-rich repeat and fibronectin type-III domain-containing protein 3 OS=Homo sapiens OX=9606 GN=LRFN3 PE=2 SV=1
14	Q9P244	0.0	706	771	0.471	0.440	LRFN1_HUMAN Leucine-rich repeat and fibronectin type III domain-containing protein 1 OS=Homo sapiens OX=9606 GN=LRFN1 PE=1 SV=2
15	Q9ULH4	0.0	682	789	0.478	0.436	LRFN2_HUMAN Leucine-rich repeat and fibronectin type-III domain-containing protein 2 OS=Homo sapiens OX=9606 GN=LRFN2 PE=1 SV=2
16	Q503I7	1.54e-40	160	647	0.174	0.193	Q503I7_DANRE Leucine rich repeat containing 4C isoform X1 OS=Danio rerio OX=7955 GN=zgc:110565 PE=1 SV=1
17	Q8C031	2.19e-39	156	640	0.174	0.195	LRC4C_MOUSE Leucine-rich repeat-containing protein 4C OS=Mus musculus OX=10090 GN=Lrrc4c PE=1 SV=2
18	Q9HCJ2	6.70e-39	155	640	0.172	0.194	LRC4C_HUMAN Leucine-rich repeat-containing protein 4C OS=Homo sapiens OX=9606 GN=LRRC4C PE=1 SV=1
19	P0CC10	3.65e-37	150	709	0.167	0.169	LRC4B_RAT Leucine-rich repeat-containing protein 4B OS=Rattus norvegicus OX=10116 GN=Lrrc4b PE=1 SV=1
20	P0C192	4.00e-37	150	709	0.167	0.169	LRC4B_MOUSE Leucine-rich repeat-containing protein 4B OS=Mus musculus OX=10090 GN=Lrrc4b PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03086 DUF240	6.1e+02	11.7	Domain of unknown function (DUF240)
2	PF00041 fn3	0.85	21.3	Fibronectin type III domain
3	PF07679 I-set	3.7e-11	54.3	Immunoglobulin I-set domain
4	PF00047 ig	8.9e-06	37.1	Immunoglobulin domain
5	PF13895 Ig_2	0.0053	28.4	Immunoglobulin domain
6	PF13927 Ig_3	5e-11	54.3	Immunoglobulin domain
7	PF00560 LRR_1	8.7e-05	33.3	Leucine Rich Repeat
8	PF12799 LRR_4	8.3e-13	59.5	Leucine Rich repeats (2 copies)
9	PF13306 LRR_5	8.7e-12	56.5	BspA type Leucine rich repeat region (6 copies)
10	PF13855 LRR_8	6.1e-38	139.7	Leucine rich repeat
11	PF14580 LRR_9	0.00043	31.4	Leucine-rich repeat

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000298119

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000349932	0.961	Receptor-type tyrosine-protein phosphatase S
2	9606.ENSP00000370593	0.954	Receptor-type tyrosine-protein phosphatase delta
3	9606.ENSP00000353030	0.840	Receptor-type tyrosine-protein phosphatase F
4	9606.ENSP00000382428	0.788	Disks large homolog 4
5	9606.ENSP00000367739	0.740	Neurensin-1
6	9606.ENSP00000386908	0.737	Multiple epidermal growth factor-like domains protein 11
7	9606.ENSP00000362639	0.736	Rab9 effector protein with kelch motifs
8	9606.ENSP00000386741	0.723	N-chimaerin
9	9606.ENSP00000381412	0.665	Calcium/calmodulin-dependent protein kinase type II subunit alpha
10	9606.ENSP00000274473	0.627	Multiple epidermal growth factor-like domains protein 10
11	9606.ENSP00000368278	0.613	Interleukin-1 receptor accessory protein-like 1
12	9606.ENSP00000321419	0.610	Olfactory receptor 4C3
13	9606.ENSP00000298097	0.605	F-box only protein 33
14	9606.ENSP00000254667	0.600	Receptor-type tyrosine-protein phosphatase epsilon
15	9606.ENSP00000369756	0.600	Receptor-type tyrosine-protein phosphatase alpha
16	9606.ENSP00000367715	0.592	Doublecortin domain-containing protein 2
17	9606.ENSP00000382178	0.579	MAM domain-containing glycosylphosphatidylinositol anchor protein 2
18	9606.ENSP00000428182	0.566	MAGUK p55 subfamily member 2
19	9606.ENSP00000385142	0.546	Neurexin-1
20	9606.ENSP00000450895	0.543	FPGT-TNNI3K readthrough

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050789	0.989	regulation of biological process
GO:0009987	0.980	cellular process
GO:0050794	0.980	regulation of cellular process
GO:0098609	0.891	cell-cell adhesion
GO:0034330	0.879	cell junction organization
GO:0048583	0.811	regulation of response to stimulus
GO:0048519	0.720	negative regulation of biological process
GO:0050808	0.709	synapse organization
GO:0032101	0.687	regulation of response to external stimulus
GO:0031347	0.679	regulation of defense response
GO:0051239	0.624	regulation of multicellular organismal process
GO:0050727	0.610	regulation of inflammatory response
GO:0002682	0.601	regulation of immune system process
GO:0050865	0.533	regulation of cell activation
GO:0032102	0.506	negative regulation of response to external stimulus
GO:0031348	0.498	negative regulation of defense response
GO:0002683	0.479	negative regulation of immune system process
GO:0043030	0.451	regulation of macrophage activation
GO:0065008	0.445	regulation of biological quality
GO:0098742	0.380	cell-cell adhesion via plasma-membrane adhesion molecules
GO:0032501	0.355	multicellular organismal process
GO:0050896	0.341	response to stimulus
GO:0050807	0.311	regulation of synapse organization
GO:0048523	0.304	negative regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.999	plasma membrane
GO:0030054	0.998	cell junction
GO:0043226	0.993	organelle
GO:0045202	0.991	synapse
GO:0098794	0.899	postsynapse
GO:0099572	0.812	postsynaptic specialization
GO:0045211	0.809	postsynaptic membrane
GO:0099634	0.790	postsynaptic specialization membrane
GO:0032279	0.767	asymmetric synapse
GO:0014069	0.744	postsynaptic density
GO:0005622	0.673	intracellular anatomical structure
GO:0043227	0.601	membrane-bounded organelle
GO:0005737	0.534	cytoplasm
GO:0098839	0.491	postsynaptic density membrane
GO:0009986	0.334	cell surface
GO:0098978	0.300	glutamatergic synapse

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]