StarFunc result for job id Q96NK8

User Input

>input (337 residues)
MLTLPFDESVVMPESQMCRKFSRECEDQKQIKKPESFSKQIVLRGKSIKRAPGEETEKEE
EEEDREEEDENGLPRRRGLRKKKTTKLRLERVKFRRQEANARERNRMHGLNDALDNLRKV
VPCYSKTQKLSKIETLRLAKNYIWALSEILRIGKRPDLLTFVQNLCKGLSQPTTNLVAGC
LQLNARSFLMGQGGEAAHHTRSPYSTFYPPYHSPELTTPPGHGTLDNSKSMKPYNYCSAY
ESFYESTSPECASPQFEGPLSPPPINYNGIFSLKQEETLDYGKNYNYGMHYCAVPPRGPL
GQGAMFRLPTDSHFPYDLHLRSQSLTMQDELNAVFHN

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P48986	0.558	0.558	2.760E-46	337	0.982	0.982	P48986.pdb.gz	NDF6_MOUSE Neurogenic differentiation factor 6 OS=Mus musculus OX=10090 GN=Neurod6 PE=2 SV=1
2	AFDB:Q6NYU3	0.433	0.444	1.544E-31	327	0.644	0.664	Q6NYU3.pdb.gz	NDF6A_DANRE Neurogenic differentiation factor 6-A OS=Danio rerio OX=7955 GN=neurod6a PE=2 SV=1
3	AFDB:O42202	0.427	0.414	2.124E-23	350	0.478	0.460	O42202.pdb.gz	NDF1_DANRE Neurogenic differentiation factor 1 OS=Danio rerio OX=7955 GN=neurod1 PE=1 SV=1
4	AFDB:Q91616	0.389	0.374	4.810E-23	352	0.510	0.489	Q91616.pdb.gz	NDF1_XENLA Neurogenic differentiation factor 1 OS=Xenopus laevis OX=8355 GN=neurod1 PE=1 SV=1
5	AFDB:Q9HD90	0.352	0.358	3.330E-20	331	0.427	0.435	Q9HD90.pdb.gz	NDF4_HUMAN Neurogenic differentiation factor 4 OS=Homo sapiens OX=9606 GN=NEUROD4 PE=1 SV=2
6	AFDB:F1QWM8	0.351	0.341	1.154E-17	348	0.412	0.399	F1QWM8.pdb.gz	F1QWM8_DANRE Neurogenic differentiation factor OS=Danio rerio OX=7955 GN=ath3 PE=4 SV=1
7	AFDB:P41894	0.196	0.175	2.716E-5	384	0.217	0.190	P41894.pdb.gz	DEI_DROME Helix-loop-helix protein delilah OS=Drosophila melanogaster OX=7227 GN=tx PE=1 SV=3
8	AFDB:O16867	0.238	0.204	7.911E-5	398	0.223	0.188	O16867.pdb.gz	TAP_DROME Basic helix-loop-helix neural transcription factor TAP OS=Drosophila melanogaster OX=7227 GN=tap PE=1 SV=2
9	AFDB:Q2QMM0	0.194	0.244	2.850E-3	266	0.113	0.143	Q2QMM0.pdb.gz	Q2QMM0_ORYSJ Helix-loop-helix DNA-binding domain containing protein OS=Oryza sativa subsp. japonica OX=39947 GN=LOC_Os12g40710 PE=3 SV=1
10	AFDB:Q16649	0.144	0.115	3.666E-3	462	0.145	0.106	Q16649.pdb.gz	NFIL3_HUMAN Nuclear factor interleukin-3-regulated protein OS=Homo sapiens OX=9606 GN=NFIL3 PE=1 SV=2
11	PDB:6mzcK	0.109	0.173	8.446E-1	202	0.056	0.094	6mzcK.pdb.gz
12	PDB:3j9xA	0.144	0.312	1.584	128	0.030	0.078	3j9xA.pdb.gz	A virus that infects a hyperthermophile encapsidates A-form DNA.
13	PDB:4d2iA	0.134	0.100	1.584	464	0.027	0.019	4d2iA.pdb.gz	Structure of the Hexameric Hera ATPase Reveals a Mechanism of Translocation-Coupled DNA-End Processing in Archaea
14	PDB:4jdqF	0.106	0.320	1.913	90	0.039	0.144	4jdqF.pdb.gz
15	PDB:4v7oAJ	0.100	0.133	2.971	250	0.018	0.024	4v7oAJ.pdb.gz
16	PDB:6vvoB	0.096	0.100	3.163	316	0.039	0.041	6vvoB.pdb.gz	Structure of the human clamp loader bound to the sliding clamp: a further twist on AAA+ mechanism
17	PDB:6t90K	0.081	0.234	3.820	73	0.033	0.151	6t90K.pdb.gz	Mechanisms of OCT4-SOX2 motif readout on nucleosomes.
18	PDB:6elzt	0.091	0.103	4.068	290	0.036	0.041	6elzt.pdb.gz	Visualizing the Assembly Pathway of Nucleolar Pre-60S Ribosomes.
19	PDB:7ungB0	0.096	0.159	4.068	193	0.065	0.114	7ungB0.pdb.gz	SPACA9 is a lumenal protein of human ciliary singlet and doublet microtubules.
20	PDB:6iczJ	0.107	0.073	4.332	571	0.062	0.037	6iczJ.pdb.gz	Structures of the human spliceosomes before and after release of the ligated exon.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P48986	0.0	692	337	0.982	0.982	NDF6_MOUSE Neurogenic differentiation factor 6 OS=Mus musculus OX=10090 GN=Neurod6 PE=2 SV=1
2	Q6NYU3	4.99e-142	406	327	0.635	0.654	NDF6A_DANRE Neurogenic differentiation factor 6-A OS=Danio rerio OX=7955 GN=neurod6a PE=2 SV=1
3	Q60867	1.20e-90	277	357	0.445	0.420	NDF1_MOUSE Neurogenic differentiation factor 1 OS=Mus musculus OX=10090 GN=Neurod1 PE=1 SV=2
4	Q64289	1.29e-90	276	357	0.445	0.420	NDF1_RAT Neurogenic differentiation factor 1 OS=Rattus norvegicus OX=10116 GN=Neurod1 PE=1 SV=1
5	Q91616	3.23e-90	275	352	0.457	0.438	NDF1_XENLA Neurogenic differentiation factor 1 OS=Xenopus laevis OX=8355 GN=neurod1 PE=1 SV=1
6	Q13562	1.19e-89	274	356	0.442	0.419	NDF1_HUMAN Neurogenic differentiation factor 1 OS=Homo sapiens OX=9606 GN=NEUROD1 PE=1 SV=3
7	O42202	1.30e-89	274	350	0.433	0.417	NDF1_DANRE Neurogenic differentiation factor 1 OS=Danio rerio OX=7955 GN=neurod1 PE=1 SV=1
8	Q15784	2.79e-87	269	382	0.442	0.390	NDF2_HUMAN Neurogenic differentiation factor 2 OS=Homo sapiens OX=9606 GN=NEUROD2 PE=1 SV=2
9	Q62414	3.00e-87	269	383	0.442	0.389	NDF2_MOUSE Neurogenic differentiation factor 2 OS=Mus musculus OX=10090 GN=Neurod2 PE=1 SV=3
10	P79765	8.68e-85	262	357	0.448	0.423	NDF1_CHICK Neurogenic differentiation factor 1 OS=Gallus gallus OX=9031 GN=NEUROD1 PE=2 SV=1
11	Q9HD90	2.87e-66	213	331	0.356	0.363	NDF4_HUMAN Neurogenic differentiation factor 4 OS=Homo sapiens OX=9606 GN=NEUROD4 PE=1 SV=2
12	O09105	7.75e-66	212	330	0.374	0.382	NDF4_MOUSE Neurogenic differentiation factor 4 OS=Mus musculus OX=10090 GN=Neurod4 PE=1 SV=1
13	D4A7M5	1.23e-64	209	330	0.341	0.348	D4A7M5_RAT Neurogenic differentiation factor OS=Rattus norvegicus OX=10116 GN=Neurod4 PE=4 SV=1
14	F1QWM8	1.09e-55	186	348	0.362	0.351	F1QWM8_DANRE Neurogenic differentiation factor OS=Danio rerio OX=7955 GN=ath3 PE=4 SV=1
15	P79920	9.97e-55	183	315	0.315	0.337	NDF4_XENLA Neurogenic differentiation factor 4 OS=Xenopus laevis OX=8355 GN=neurod4 PE=1 SV=1
16	P46581	1.43e-27	108	192	0.157	0.276	NDF1_CAEEL Neurogenic differentiation factor 1 OS=Caenorhabditis elegans OX=6239 GN=cnd-1 PE=2 SV=1
17	O42606	3.12e-21	92.0	208	0.139	0.226	NGN1_DANRE Neurogenin-1 OS=Danio rerio OX=7955 GN=neurog1 PE=2 SV=1
18	Q9Y4Z2	1.01e-20	90.9	214	0.154	0.243	NGN3_HUMAN Neurogenin-3 OS=Homo sapiens OX=9606 GN=NEUROG3 PE=1 SV=2
19	P70661	4.50e-20	89.0	214	0.131	0.206	NGN3_MOUSE Neurogenin-3 OS=Mus musculus OX=10090 GN=Neurog3 PE=1 SV=1
20	O08718	4.69e-20	89.0	214	0.131	0.206	O08718_RAT Neurogenin 3 OS=Rattus norvegicus OX=10116 GN=Neurog3 PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF15794 CCDC106	1.7e+02	13.3	Coiled-coil domain-containing protein 106
2	PF00010 HLH	1.1e-12	59.1	Helix-loop-helix DNA-binding domain
3	PF12533 Neuro_bHLH	2.7e-38	143.4	Neuronal helix-loop-helix transcription factor

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61853.ENSNLEP00000018483

Rank	PPI partner	STRING score	Description
1	61853.ENSNLEP00000006223	0.691	CTD small phosphatase like
2	61853.ENSNLEP00000015103	0.627	Complement C1q like 3
3	61853.ENSNLEP00000006205	0.599	Belongs to the integrin alpha chain family.
4	61853.ENSNLEP00000018526	0.569	Phosphodiesterase 1C, calmodulin-dependent 70kDa
5	61853.ENSNLEP00000018434	0.565	Corticotropin releasing hormone receptor 2
6	61853.ENSNLEP00000004824	0.534	Transcription factor AP-2 delta (activating enhancer binding protein 2 delta)
7	61853.ENSNLEP00000018470	0.533	Growth hormone releasing hormone receptor
8	61853.ENSNLEP00000010508	0.520	CTD small phosphatase 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0000981	1.000	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0005515	0.997	protein binding
GO:0001216	0.996	DNA-binding transcription activator activity
GO:0000978	0.996	RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0001228	0.989	DNA-binding transcription activator activity, RNA polymerase II-specific

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0065007	0.997	biological regulation
GO:0050794	0.992	regulation of cellular process
GO:0032502	0.945	developmental process
GO:0048856	0.943	anatomical structure development
GO:0051171	0.940	regulation of nitrogen compound metabolic process
GO:0031323	0.937	regulation of cellular metabolic process
GO:0032501	0.934	multicellular organismal process
GO:0010468	0.934	regulation of gene expression
GO:0080090	0.925	regulation of primary metabolic process
GO:0048518	0.898	positive regulation of biological process
GO:0007275	0.896	multicellular organism development
GO:0048522	0.884	positive regulation of cellular process
GO:0048731	0.859	system development
GO:0009889	0.843	regulation of biosynthetic process
GO:0007399	0.840	nervous system development
GO:0031326	0.813	regulation of cellular biosynthetic process
GO:0009987	0.811	cellular process
GO:0010556	0.779	regulation of macromolecule biosynthetic process
GO:0051252	0.768	regulation of RNA metabolic process
GO:2001141	0.743	regulation of RNA biosynthetic process
GO:0007417	0.651	central nervous system development
GO:1903506	0.640	regulation of nucleic acid-templated transcription
GO:0060322	0.532	head development
GO:0006355	0.532	regulation of DNA-templated transcription
GO:0007420	0.517	brain development
GO:0009893	0.476	positive regulation of metabolic process
GO:0010604	0.466	positive regulation of macromolecule metabolic process
GO:0030900	0.456	forebrain development
GO:0006357	0.412	regulation of transcription by RNA polymerase II
GO:0051254	0.319	positive regulation of RNA metabolic process
GO:0045893	0.312	positive regulation of DNA-templated transcription

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0016020	0.425	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]