StarFunc result for job id Q96NN9

User Input

>input (605 residues)
MGGCFSKPKPVELKIEVVLPEKERGKEELSASGKGSPRAYQGNGTARHFHTEERLSTPHP
YPSPQDCVEAAVCHVKDLENGQMREVELGWGKVLLVKDNGEFHALGHKCPHYGAPLVKGV
LSRGRVRCPWHGACFNISTGDLEDFPGLDSLHKFQVKIEKEKVYVRASKQALQLQRRTKV
MAKCISPSAGYSSSTNVLIVGAGAAGLVCAETLRQEGFSDRIVLCTLDRHLPYDRPKLSK
SLDTQPEQLALRPKEFFRAYGIEVLTEAQVVTVDVRTKKVVFKDGFKLEYSKLLLAPGSS
PKTLSCKGKEVENVFTIRTPEDANRVVRLARGRNVVVVGAGFLGMEVAAYLTEKAHSVSV
VELEETPFRRFLGERVGRALMKMFENNRVKFYMQTEVSELRGQEGKLKEVVLKSSKVVRA
DVCVVGIGAVPATGFLRQSGIGLDSRGFIPVNKMMQTNVPGVFAAGDAVTFPLAWRNNRK
VNIPHWQMAHAQGRVAAQNMLAQEAEMSTVPYLWTAMFGKSLRYAGYGEGFDDVIIQGDL
EELKFVAFYTKGDEVIAVASMNYDPIVSKVAEVLASGRAIRKREVELFVLHSKTGDMSWL
TGKGS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q3TY86	0.927	0.927	0.000	605	0.960	0.960	Q3TY86.pdb.gz	AIFM3_MOUSE Apoptosis-inducing factor 3 OS=Mus musculus OX=10090 GN=Aifm3 PE=1 SV=1
2	AFDB:F2Z4R3	0.882	0.891	3.949E-100	599	0.660	0.666	F2Z4R3.pdb.gz	F2Z4R3_DANRE Apoptosis-inducing factor 3 OS=Danio rerio OX=7955 GN=aifm3 PE=4 SV=1
3	AFDB:Q10499	0.823	0.815	9.710E-58	611	0.312	0.309	Q10499.pdb.gz	AIF1_SCHPO Apoptosis-inducing factor 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=aif1 PE=3 SV=3
4	AFDB:X5CY81	0.591	0.865	7.141E-43	410	0.183	0.271	X5CY81.pdb.gz	CNDC1_RHIWD Chloroacetanilide N-alkylformylase, ferredoxin reductase component OS=Rhizorhabdus wittichii (strain DC-6 / KACC 16600) OX=1283312 GN=cndC1 PE=1 SV=1
5	AFDB:D5IGG6	0.589	0.856	1.998E-42	414	0.179	0.261	D5IGG6.pdb.gz	FDR_SPHSX Ferredoxin--NAD(P)(+) reductase fdr OS=Sphingomonas sp. OX=28214 GN=fdr PE=1 SV=1
6	AFDB:P95146	0.624	0.909	2.080E-41	411	0.203	0.299	P95146.pdb.gz	P95146_MYCTU Probable reductase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=Rv1869c PE=1 SV=1
7	AFDB:P16640	0.602	0.855	2.835E-39	422	0.183	0.263	P16640.pdb.gz	CAMA_PSEPU Putidaredoxin reductase CamA OS=Pseudomonas putida OX=303 GN=camA PE=1 SV=1
8	PDB:1q1wA	0.612	0.868	5.422E-39	422	0.179	0.256	1q1wA.pdb.gz	Crystal structure of putidaredoxin reductase from Pseudomonas putida, the final structural component of the cytochrome P450cam monooxygenase.
9	AFDB:P95034	0.609	0.896	7.073E-39	406	0.205	0.305	P95034.pdb.gz	P95034_MYCTU Ferredoxin reductase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=Rv0688 PE=1 SV=1
10	AFDB:P17052	0.589	0.911	1.838E-37	385	0.170	0.268	P17052.pdb.gz	RURE_PSEOL Rubredoxin-NAD(+) reductase OS=Pseudomonas oleovorans OX=301 GN=alkT PE=1 SV=1
11	AFDB:P77650	0.597	0.885	2.445E-37	400	0.179	0.270	P77650.pdb.gz	HCAD_ECOLI 3-phenylpropionate/cinnamic acid dioxygenase ferredoxin--NAD(+) reductase component OS=Escherichia coli (strain K12) OX=83333 GN=hcaD PE=1 SV=1
12	PDB:5jciA	0.617	0.855	5.782E-36	432	0.165	0.231	5jciA.pdb.gz	Structure and catalytic mechanism of monodehydroascorbate reductase, MDHAR, from Oryza sativa L. japonica
13	PDB:2v3aA	0.545	0.845	1.488E-30	381	0.139	0.220	2v3aA.pdb.gz	Crystal Structure of the Electron Transfer Complex Rubredoxin - Rubredoxin Reductase from Pseudomonas Aeruginosa.
14	PDB:3kljA	0.525	0.816	4.094E-29	378	0.145	0.233	3kljA.pdb.gz	Crystal structure of NADH:rubredoxin oxidoreductase from Clostridium acetobutylicum: a key component of the dioxygen scavenging system in obligatory anaerobes.
15	PDB:6zk7AAAA	0.471	0.652	3.766E-24	425	0.132	0.188	6zk7AAAA.pdb.gz	The oxidoreductase PYROXD1 uses NAD(P) + as an antioxidant to sustain tRNA ligase activity in pre-tRNA splicing and unfolded protein response.
16	PDB:4jdrA	0.529	0.665	1.975E-23	471	0.127	0.163	4jdrA.pdb.gz	Insight to the Interaction of the Dihydrolipoamide Acetyltransferase (E2) Core with the Peripheral Components in the Escherichia coli Pyruvate Dehydrogenase Complex via Multifaceted Structural Approaches.
17	PDB:1ebdA	0.490	0.636	7.786E-23	455	0.142	0.189	1ebdA.pdb.gz	Protein-protein interactions in the pyruvate dehydrogenase multienzyme complex: dihydrolipoamide dehydrogenase complexed with the binding domain of dihydrolipoamide acetyltransferase.
18	PDB:6hg8B	0.490	0.603	3.249E-22	482	0.144	0.180	6hg8B.pdb.gz	Crystal structure of the R460G disease-causing mutant of the human dihydrolipoamide dehydrogenase.
19	PDB:6btlA	0.475	0.573	5.754E-22	492	0.126	0.154	6btlA.pdb.gz	Biological Evaluation and X-ray Co-crystal Structures of Cyclohexylpyrrolidine Ligands for Trypanothione Reductase, an Enzyme from the Redox Metabolism of Trypanosoma.
20	PDB:1gerB	0.461	0.609	1.804E-21	449	0.109	0.147	1gerB.pdb.gz	Structure of glutathione reductase from Escherichia coli at 1.86 A resolution: comparison with the enzyme from human erythrocytes.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	C9K029	0.0	1217	596	0.985	1.000	C9K029_HUMAN Apoptosis inducing factor mitochondria associated 3 OS=Homo sapiens OX=9606 GN=AIFM3 PE=1 SV=3
2	F2Z4R3	0.0	848	599	0.666	0.673	F2Z4R3_DANRE Apoptosis-inducing factor 3 OS=Danio rerio OX=7955 GN=aifm3 PE=4 SV=1
3	Q3TY86	0.0	1207	605	0.960	0.960	AIFM3_MOUSE Apoptosis-inducing factor 3 OS=Mus musculus OX=10090 GN=Aifm3 PE=1 SV=1
4	Q96NN9	0.0	1247	605	1.000	1.000	AIFM3_HUMAN Apoptosis-inducing factor 3 OS=Homo sapiens OX=9606 GN=AIFM3 PE=1 SV=1
5	Q10499	3.92e-91	295	611	0.304	0.301	AIF1_SCHPO Apoptosis-inducing factor 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=aif1 PE=3 SV=3
6	P95146	3.19e-51	184	411	0.200	0.294	P95146_MYCTU Probable reductase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=Rv1869c PE=1 SV=1
7	P95034	1.20e-48	176	406	0.193	0.288	P95034_MYCTU Ferredoxin reductase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=Rv0688 PE=1 SV=1
8	D5IGG6	4.59e-45	167	414	0.180	0.263	FDR_SPHSX Ferredoxin--NAD(P)(+) reductase fdr OS=Sphingomonas sp. OX=28214 GN=fdr PE=1 SV=1
9	X5CY81	1.39e-43	162	410	0.183	0.271	CNDC1_RHIWD Chloroacetanilide N-alkylformylase, ferredoxin reductase component OS=Rhizorhabdus wittichii (strain DC-6 / KACC 16600) OX=1283312 GN=cndC1 PE=1 SV=1
10	P16640	2.26e-39	151	422	0.182	0.261	CAMA_PSEPU Putidaredoxin reductase CamA OS=Pseudomonas putida OX=303 GN=camA PE=1 SV=1
11	P77650	2.47e-37	145	400	0.180	0.273	HCAD_ECOLI 3-phenylpropionate/cinnamic acid dioxygenase ferredoxin--NAD(+) reductase component OS=Escherichia coli (strain K12) OX=83333 GN=hcaD PE=1 SV=1
12	P17052	5.20e-36	141	385	0.175	0.275	RURE_PSEOL Rubredoxin-NAD(+) reductase OS=Pseudomonas oleovorans OX=301 GN=alkT PE=1 SV=1
13	P92947	2.32e-30	127	493	0.157	0.193	MDAR_ARATH Monodehydroascorbate reductase, chloroplastic/mitochondrial OS=Arabidopsis thaliana OX=3702 GN=MDAR5 PE=1 SV=3
14	A7LKG5	3.22e-29	122	440	0.157	0.216	A7LKG5_ALKPO NADH dehydrogenase, NDH-2B OS=Alkalihalophilus pseudofirmus (strain ATCC BAA-2126 / JCM 17055 / OF4) OX=398511 GN=ndhB PE=4 SV=1
15	Q9SR59	2.59e-28	120	441	0.159	0.218	MDAR3_ARATH Monodehydroascorbate reductase 3 OS=Arabidopsis thaliana OX=3702 GN=MDAR3 PE=2 SV=1
16	Q652L6	4.81e-28	119	435	0.167	0.232	MDAR3_ORYSJ Monodehydroascorbate reductase 3, cytosolic OS=Oryza sativa subsp. japonica OX=39947 GN=MDAR3 PE=1 SV=1
17	Q9LK94	4.42e-27	117	488	0.170	0.211	MDAR4_ARATH Monodehydroascorbate reductase 4, peroxisomal OS=Arabidopsis thaliana OX=3702 GN=MDAR4 PE=1 SV=1
18	P42454	1.78e-25	110	393	0.132	0.204	RURE_ACIAD Rubredoxin-NAD(+) reductase OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) OX=62977 GN=rubB PE=1 SV=2
19	F4J849	9.70e-25	110	466	0.170	0.221	F4J849_ARATH Monodehydroascorbate reductase 1 OS=Arabidopsis thaliana OX=3702 GN=MDAR1 PE=1 SV=1
20	Q93WJ8	3.27e-23	105	435	0.149	0.207	MDAR2_ARATH Monodehydroascorbate reductase 2 OS=Arabidopsis thaliana OX=3702 GN=MDAR2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02737 3HCDH_N	6	18.2	3-hydroxyacyl-CoA dehydrogenase, NAD binding domain
2	PF01262 AlaDh_PNT_C	3.7e+02	11.8	Alanine dehydrogenase/PNT, C-terminal domain
3	PF02558 ApbA	14	16.8	Ketopantoate reductase PanE/ApbA
4	PF00118 Cpn60_TCP1	2.3e+02	11.8	TCP-1/cpn60 chaperonin family
5	PF01266 DAO	7.2e-06	37.4	FAD dependent oxidoreductase
6	PF04016 DUF364	7.8e+02	11.1	Putative heavy-metal chelation
7	PF00890 FAD_binding_2	0.0012	29.7	FAD binding domain
8	PF01494 FAD_binding_3	0.0026	28.7	FAD binding domain
9	PF01134 GIDA	1.3	19.7	Glucose inhibited division protein A
10	PF16912 Glu_dehyd_C	43	15.0	Glucose dehydrogenase C-terminus
11	PF00732 GMC_oxred_N	80	14.1	GMC oxidoreductase
12	PF06690 HcgC	1.3e+02	13.5	FeGP cofactor biosynthesis protein, methyltransferase HcgC
13	PF03486 HI0933_like	5e-06	37.1	HI0933-like protein
14	PF05834 Lycopene_cycl	0.5	21.0	Lycopene cyclase protein
15	PF13434 Lys_Orn_oxgnase	1.1e+02	13.4	L-lysine 6-monooxygenase/L-ornithine 5-monooxygenase
16	PF13241 NAD_binding_7	53	15.7	Putative NAD(P)-binding
17	PF13450 NAD_binding_8	6e-06	37.7	NAD(P)-binding Rossmann-like domain
18	PF13454 NAD_binding_9	0.15	23.6	FAD-NAD(P)-binding
19	PF01210 NAD_Gly3P_dh_N	4.1e+02	12.4	NAD-dependent glycerol-3-phosphate dehydrogenase N-terminus
20	PF17836 PglD_N	4.1e+02	13.0	PglD N-terminal domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000382120

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000389813	0.876	Acyl-CoA dehydrogenase family member 10
2	9606.ENSP00000348775	0.802	Peroxisomal acyl-coenzyme A oxidase 3
3	9606.ENSP00000372390	0.766	Cationic amino acid transporter 4
4	9606.ENSP00000215739	0.765	Leucine-zipper-like transcriptional regulator 1
5	9606.ENSP00000341351	0.764	DDB1- and CUL4-associated factor 5
6	9606.ENSP00000417229	0.764	Eukaryotic translation initiation factor 2A
7	9606.ENSP00000264990	0.732	Acyl-CoA dehydrogenase family member 11
8	9606.ENSP00000215742	0.715	THAP domain-containing protein 7
9	9606.ENSP00000331682	0.704	Kelch-like protein 22
10	9606.ENSP00000215730	0.685	Synaptosomal-associated protein 29
11	9606.ENSP00000299432	0.628	Putative protein MSS51 homolog, mitochondrial
12	9606.ENSP00000255882	0.624	Phosphatidylinositol 4-kinase alpha
13	9606.ENSP00000215727	0.622	Heparin cofactor 2
14	9606.ENSP00000292475	0.609	ATP synthase subunit f, mitochondrial
15	9606.ENSP00000450353	0.594	Uncharacterized protein
16	9606.ENSP00000407761	0.592	Acyl-coenzyme A oxidase-like protein
17	9606.ENSP00000403293	0.567	F-box only protein 43
18	9606.ENSP00000280701	0.564	3-oxoacyl-[acyl-carrier-protein] synthase, mitochondrial
19	9606.ENSP00000477564	0.564	Scavenger receptor class F member 2
20	9606.ENSP00000377668	0.543	Sulfite oxidase, mitochondrial

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0016491	0.998	oxidoreductase activity
GO:0005515	0.996	protein binding
GO:1901363	0.807	heterocyclic compound binding
GO:0097159	0.718	organic cyclic compound binding
GO:0043167	0.497	ion binding
GO:0036094	0.360	small molecule binding
GO:0050660	0.345	flavin adenine dinucleotide binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.990	cellular process
GO:0006915	0.946	apoptotic process
GO:0097194	0.923	execution phase of apoptosis
GO:0008152	0.684	metabolic process
GO:0071704	0.635	organic substance metabolic process
GO:0044237	0.507	cellular metabolic process
GO:0044238	0.373	primary metabolic process
GO:0065007	0.358	biological regulation
GO:0050789	0.335	regulation of biological process
GO:0050794	0.310	regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	1.000	mitochondrion
GO:0005829	0.979	cytosol
GO:0016020	0.644	membrane
GO:0070013	0.412	intracellular organelle lumen
GO:0031975	0.346	envelope
GO:0031967	0.342	organelle envelope
GO:0005740	0.319	mitochondrial envelope

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:1.-.-.-	0.998	Oxidoreductases.

[back to server]