StarFunc result for job id Q96NR7

User Input

>input (200 residues)
MTSAETASRAAESGGTPVRPCSRPHRAPSPAAPSRPGAPAAGPRKLLVPGLPCLVRGGWP
WTRPDSSPFRPAARPRMSPHRSPAVARRCGRPRRRDPRRRRTPALPRPWPGRGGPGRSLL
HRHLFIQQLLRTCWPALPRDRTPAPGGTMPGAALAGPGRQASGSPAPQSEGAPPRPWTPL
QPGLHHRPPSSSSGLLSSFF

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0PJY2	0.122	0.059	1.606	475	0.220	0.093	A0PJY2.pdb.gz	FEZF1_HUMAN Fez family zinc finger protein 1 OS=Homo sapiens OX=9606 GN=FEZF1 PE=1 SV=1
2	AFDB:O94714	0.123	0.068	1.992	406	0.145	0.071	O94714.pdb.gz	SPT2_SCHPO Protein spt2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=spt2 PE=3 SV=1
3	AFDB:A0A024R0V4	0.132	0.080	2.300	380	0.190	0.100	A0A024R0V4.pdb.gz	A0A024R0V4_HUMAN Vasodilator-stimulated phosphoprotein isoform 1 (Fragment) OS=Homo sapiens OX=9606 GN=VASP PE=2 SV=1
4	AFDB:Q9VRC5	0.116	0.111	2.300	215	0.130	0.121	Q9VRC5.pdb.gz	Q9VRC5_DROME AT30947p OS=Drosophila melanogaster OX=7227 GN=I-3 PE=2 SV=4
5	AFDB:E9PMQ6	0.130	0.071	2.471	495	0.225	0.091	E9PMQ6.pdb.gz	E9PMQ6_HUMAN Heat shock transcription factor 1 OS=Homo sapiens OX=9606 GN=HSF1 PE=1 SV=2
6	AFDB:A0A1W2PQ30	0.110	0.124	3.802	174	0.145	0.167	A0A1W2PQ30.pdb.gz	A0A1W2PQ30_HUMAN GRAM domain containing 1B OS=Homo sapiens OX=9606 GN=GRAMD1B PE=1 SV=1
7	AFDB:A8JUP7	0.114	0.048	4.086	637	0.180	0.057	A8JUP7.pdb.gz	HAYAN_DROME Serine protease Hayan OS=Drosophila melanogaster OX=7227 GN=Hayan PE=2 SV=1
8	AFDB:F1M8G0	0.102	0.036	4.086	762	0.175	0.046	F1M8G0.pdb.gz	PHTF1_RAT Protein PHTF1 OS=Rattus norvegicus OX=10116 GN=Phtf1 PE=1 SV=1
9	AFDB:Q03653	0.127	0.041	4.390	782	0.140	0.036	Q03653.pdb.gz	EFR3_YEAST Protein EFR3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=EFR3 PE=1 SV=1
10	AFDB:Q3SYA9	0.122	0.066	4.717	428	0.220	0.103	Q3SYA9.pdb.gz	P12L1_HUMAN Putative POM121-like protein 1 OS=Homo sapiens OX=9606 GN=POM121L1P PE=5 SV=2

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A8I5ZUN3	0.31	34.3	35375	0.210	0.001	A0A8I5ZUN3_RAT Titin OS=Rattus norvegicus OX=10116 GN=Ttn PE=1 SV=1
2	P19334	0.83	32.7	1275	0.075	0.012	TRP_DROME Transient receptor potential protein OS=Drosophila melanogaster OX=7227 GN=trp PE=1 SV=3
3	Q8RYD6	1.3	32.0	331	0.100	0.060	AI5L1_ARATH ABSCISIC ACID-INSENSITIVE 5-like protein 1 OS=Arabidopsis thaliana OX=3702 GN=DPBF2 PE=1 SV=1
4	Q86Y91	1.9	31.6	852	0.120	0.028	KI18B_HUMAN Kinesin-like protein KIF18B OS=Homo sapiens OX=9606 GN=KIF18B PE=1 SV=4
5	A0A494BYR6	2.0	31.6	842	0.120	0.029	A0A494BYR6_HUMAN Kinesin-like protein OS=Homo sapiens OX=9606 GN=KIF18B PE=1 SV=1
6	A0A2C9C2L6	7.3	30.0	624	0.160	0.051	A0A2C9C2L6_CAEEL Intraflagellar transport protein 74 homolog OS=Caenorhabditis elegans OX=6239 GN=ift-74 PE=4 SV=1
7	Q9GZH5	8.4	29.6	981	0.075	0.015	Q9GZH5_CAEEL 26S proteasome non-ATPase regulatory subunit 2 OS=Caenorhabditis elegans OX=6239 GN=rpn-1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 1121367.AQXC01000001_gene1524

Rank	PPI partner	STRING score	Description
1	1121367.AQXC01000001_gene1549	0.999	Belongs to the universal ribosomal protein uS2 family.
2	1121367.AQXC01000011_gene1145	0.999	One of the primary rRNA binding proteins, it binds directly to 16S rRNA where it nucleates assembly of the body of the 30S subunit.
3	1121367.AQXC01000011_gene1146	0.999	Located on the platform of the 30S subunit, it bridges several disparate RNA helices of the 16S rRNA. Forms part of the Shine- Dalgarno cleft in the 70S ribosome
4	1121367.AQXC01000011_gene1154	0.999	Located at the back of the 30S subunit body where it stabilizes the conformation of the head with respect to the body.
5	1121367.AQXC01000011_gene1157	0.999	One of the primary rRNA binding proteins, it binds directly to 16S rRNA central domain where it helps coordinate assembly of the platform of the 30S subunit
6	1121367.AQXC01000011_gene1171	0.999	Binds the lower part of the 30S subunit head. Binds mRNA in the 70S ribosome, positioning it for translation
7	1121367.AQXC01000011_gene1188	0.999	One of the primary rRNA binding proteins, it binds directly to 16S rRNA where it nucleates assembly of the head domain of the 30S subunit. Is located at the subunit interface close to the decoding center, probably blocks exit of the E-site tRNA
8	1121367.AQXC01000001_gene1516	0.998	Forms an intersubunit bridge (bridge B4) with the 23S rRNA of the 50S subunit in the ribosome
9	1121367.AQXC01000010_gene983	0.998	Binds 16S rRNA, required for the assembly of 30S particles and may also be responsible for determining the conformation of the 16S rRNA at the A site
10	1121367.AQXC01000011_gene1168	0.998	One of the primary rRNA binding proteins, it binds specifically to the 5'-end of 16S ribosomal RNA
11	1121367.AQXC01000011_gene1173	0.998	Protein S19 forms a complex with S13 that binds strongly to the 16S ribosomal RNA
12	1121367.AQXC01000011_gene1178	0.998	Involved in the binding of tRNA to the ribosomes.
13	1121367.AQXC01000011_gene1189	0.998	Interacts with and stabilizes bases of the 16S rRNA that are involved in tRNA selection in the A site and with the mRNA backbone. Located at the interface of the 30S and 50S subunits, it traverses the body of the 30S subunit contacting proteins on the other side and probably holding the rRNA structure together. The combined cluster of proteins S8, S12 and S17 appears to hold together the shoulder and platform of the 30S subunit
14	1121367.AQXC01000001_gene1568	0.996	Belongs to the bacterial ribosomal protein bS16 family.
15	1121367.AQXC01000002_gene2088	0.996	IF-3 binds to the 30S ribosomal subunit and shifts the equilibrum between 70S ribosomes and their 50S and 30S subunits in favor of the free subunits, thus enhancing the availability of 30S subunits on which protein synthesis initiation begins.
16	1121367.AQXC01000011_gene1174	0.995	One of the primary rRNA binding proteins. Required for association of the 30S and 50S subunits to form the 70S ribosome, for tRNA binding and peptide bond formation. It has been suggested to have peptidyltransferase activity
17	1121367.AQXC01000016_gene2	0.995	Belongs to the universal ribosomal protein uS9 family.
18	1121367.AQXC01000005_gene805	0.992	Binds together with S18 to 16S ribosomal RNA.
19	1121367.AQXC01000011_gene1148	0.991	One of the essential components for the initiation of protein synthesis. Stabilizes the binding of IF-2 and IF-3 on the 30S subunit to which N-formylmethionyl-tRNA(fMet) subsequently binds. Helps modulate mRNA selection, yielding the 30S pre-initiation complex (PIC). Upon addition of the 50S ribosomal subunit IF-1, IF-2 and IF-3 are released leaving the mature 70S translation initiation complex.
20	1121367.AQXC01000011_gene1172	0.991	The globular domain of the protein is located near the polypeptide exit tunnel on the outside of the subunit, while an extended beta-hairpin is found that lines the wall of the exit tunnel in the center of the 70S ribosome

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.666	regulation of cellular process
GO:0061136	0.350	regulation of proteasomal protein catabolic process
GO:0031331	0.350	positive regulation of cellular catabolic process
GO:2000058	0.327	regulation of ubiquitin-dependent protein catabolic process
GO:0010508	0.326	positive regulation of autophagy

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005622	0.995	intracellular anatomical structure
GO:0043227	0.995	membrane-bounded organelle
GO:0043231	0.989	intracellular membrane-bounded organelle
GO:0005737	0.800	cytoplasm
GO:0005634	0.707	nucleus
GO:0043232	0.498	intracellular non-membrane-bounded organelle
GO:0031974	0.480	membrane-enclosed lumen
GO:0043233	0.472	organelle lumen
GO:0070013	0.460	intracellular organelle lumen
GO:0005739	0.407	mitochondrion
GO:0005764	0.391	lysosome
GO:0005730	0.383	nucleolus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]