StarFunc result for job id Q96NS1

User Input

>input (127 residues)
MPSCDPGPGPACLPTKTFRSYLPRCHRTYSCVHCRAHLAKHDELISKSFQGSHGRAYLFN
SVVNVGCGPAEQRLLLTGLHSVADIFCESCKTTLGWKYEQAFETSQKYKEGKYIIEMSHM
VKDNGWD

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q65Z93	0.853	0.853	7.890E-23	127	0.992	0.992	Q65Z93.pdb.gz	YPEL4_MOUSE Protein yippee-like 4 OS=Mus musculus OX=10090 GN=Ypel4 PE=2 SV=1
2	AFDB:Q96QA6	0.869	0.926	5.809E-19	119	0.756	0.807	Q96QA6.pdb.gz	YPEL2_HUMAN Protein yippee-like 2 OS=Homo sapiens OX=9606 GN=YPEL2 PE=1 SV=1
3	AFDB:Q9W2X7	0.867	0.964	1.059E-18	114	0.685	0.763	Q9W2X7.pdb.gz	YPL1_DROME Protein yippee-like OS=Drosophila melanogaster OX=7227 GN=Ypel PE=2 SV=1
4	AFDB:Q6NWI4	0.856	0.912	1.318E-18	119	0.748	0.798	Q6NWI4.pdb.gz	YPEL3_DANRE Protein yippee-like 3 OS=Danio rerio OX=7955 GN=ypel3 PE=3 SV=1
5	AFDB:P61236	0.853	0.908	4.151E-18	119	0.740	0.790	P61236.pdb.gz	YPEL3_HUMAN Protein yippee-like 3 OS=Homo sapiens OX=9606 GN=YPEL3 PE=2 SV=1
6	AFDB:Q9XZF0	0.776	0.813	1.325E-12	121	0.354	0.372	Q9XZF0.pdb.gz	YIPP_DROME Protein yippee OS=Drosophila melanogaster OX=7227 GN=Ype PE=1 SV=1
7	AFDB:P62699	0.770	0.808	1.561E-12	121	0.354	0.372	P62699.pdb.gz	YPEL5_HUMAN Protein yippee-like 5 OS=Homo sapiens OX=9606 GN=YPEL5 PE=1 SV=1
8	AFDB:Q2V3E2	0.753	0.909	2.288E-12	105	0.339	0.410	Q2V3E2.pdb.gz	YIPL5_ARATH Protein yippee-like At4g27740 OS=Arabidopsis thaliana OX=3702 GN=At4g27740 PE=3 SV=1
9	AFDB:A0A024R9N0	0.641	0.372	1.951E-6	229	0.213	0.118	A0A024R9N0.pdb.gz
10	AFDB:Q9CZJ6	0.653	0.418	3.191E-6	204	0.142	0.088	Q9CZJ6.pdb.gz	MS18A_MOUSE Protein Mis18-alpha OS=Mus musculus OX=10090 GN=Mis18a PE=2 SV=1
11	PDB:6symA	0.466	0.441	5.968E-4	135	0.134	0.126	6symA.pdb.gz	Structure of Peptide methionine sulfoxide reductase MsrB at 1.63 Angstrom resolution
12	PDB:6h0gB	0.604	0.209	8.748E-4	401	0.126	0.040	6h0gB.pdb.gz	Defining the human C2H2 zinc finger degrome targeted by thalidomide analogs through CRBN.
13	PDB:5fqdE	0.597	0.229	9.239E-4	367	0.134	0.046	5fqdE.pdb.gz	Structural Basis of Lenalidomide-Induced Ck1Alpha Degradation by the Crl4(Crbn) Ubiquitin Ligase.
14	PDB:7tnxA	0.514	0.117	6.200E-2	647	0.142	0.028	7tnxA.pdb.gz	The RIG-I receptor adopts two different conformations for distinguishing host from viral RNA ligands.
15	PDB:6h61A	0.411	0.093	1.194E-1	660	0.087	0.017	6h61A.pdb.gz	Cryo-EM Structures of MDA5-dsRNA Filaments at Different Stages of ATP Hydrolysis.
16	PDB:8dvsA	0.518	0.112	2.300E-1	682	0.126	0.023	8dvsA.pdb.gz	The RIG-I receptor adopts two different conformations for distinguishing host from viral RNA ligands.
17	PDB:5zrtA	0.130	0.112	7.650E-1	160	0.126	0.100	5zrtA.pdb.gz	Crystal structure and functional analysis of human C1ORF123.
18	PDB:7bkpA	0.325	0.079	8.534E-1	689	0.079	0.015	7bkpA.pdb.gz	MDA5 disease variant M854K prevents ATP-dependent structural discrimination of viral and cellular RNA.
19	PDB:4by6E	0.137	0.118	9.519E-1	168	0.047	0.036	4by6E.pdb.gz	Structure and RNA-Binding Properties of the not1-not2-not5 Module of the Yeast Ccr4-not Complex
20	PDB:2bz0B	0.227	0.170	1.005	173	0.008	0.006	2bz0B.pdb.gz	GTP Cyclohydrolase II Structure and Mechanism.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q65Z93	4.04e-94	268	127	0.992	0.992	YPEL4_MOUSE Protein yippee-like 4 OS=Mus musculus OX=10090 GN=Ypel4 PE=2 SV=1
2	Q96QA6	5.88e-74	217	119	0.756	0.807	YPEL2_HUMAN Protein yippee-like 2 OS=Homo sapiens OX=9606 GN=YPEL2 PE=1 SV=1
3	Q6NWI4	1.58e-71	211	119	0.748	0.798	YPEL3_DANRE Protein yippee-like 3 OS=Danio rerio OX=7955 GN=ypel3 PE=3 SV=1
4	P61236	1.20e-70	209	119	0.740	0.790	YPEL3_HUMAN Protein yippee-like 3 OS=Homo sapiens OX=9606 GN=YPEL3 PE=2 SV=1
5	Q9W2X7	1.43e-64	193	114	0.685	0.763	YPL1_DROME Protein yippee-like OS=Drosophila melanogaster OX=7227 GN=Ypel PE=2 SV=1
6	P62699	2.79e-27	99.4	121	0.354	0.372	YPEL5_HUMAN Protein yippee-like 5 OS=Homo sapiens OX=9606 GN=YPEL5 PE=1 SV=1
7	Q65Z55	2.79e-27	99.4	121	0.354	0.372	YPEL5_CHLAE Protein yippee-like 5 OS=Chlorocebus aethiops OX=9534 GN=YPEL5 PE=2 SV=1
8	Q9XZF0	2.54e-26	97.1	121	0.339	0.355	YIPP_DROME Protein yippee OS=Drosophila melanogaster OX=7227 GN=Ype PE=1 SV=1
9	Q2V3E2	5.99e-25	93.2	105	0.339	0.410	YIPL5_ARATH Protein yippee-like At4g27740 OS=Arabidopsis thaliana OX=3702 GN=At4g27740 PE=3 SV=1
10	P39643	1.1	30.8	399	0.134	0.043	BACF_BACSU Transaminase BacF OS=Bacillus subtilis (strain 168) OX=224308 GN=bacF PE=1 SV=1
11	Q96C74	2.2	29.6	230	0.157	0.087	ROP1L_HUMAN Ropporin-1-like protein OS=Homo sapiens OX=9606 GN=ROPN1L PE=1 SV=2
12	Q6TVJ2	4.6	29.3	501	0.142	0.036	Q6TVJ2_ORFSA ORF128 ankyrin repeat protein OS=Orf virus (strain Goat/Texas/SA00/2000) OX=647330 PE=1 SV=1
13	Q54NU8	5.6	28.9	1408	0.094	0.009	TSTA_DICDI TSET complex member tstA OS=Dictyostelium discoideum OX=44689 GN=tstA PE=1 SV=1
14	Q2R3B4	8.0	28.5	469	0.071	0.019	GH313_ORYSJ Probable indole-3-acetic acid-amido synthetase GH3.13 OS=Oryza sativa subsp. japonica OX=39947 GN=GH3.13 PE=2 SV=1
15	Q6TVJ4	8.0	28.5	497	0.134	0.034	Q6TVJ4_ORFSA ORF126 ankyrin repeat protein OS=Orf virus (strain Goat/Texas/SA00/2000) OX=647330 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF11606 AlcCBM31	1e+02	14.5	Family 31 carbohydrate binding protein
2	PF14398 ATPgrasp_YheCD	47	14.7	YheC/D like ATP-grasp
3	PF03226 Yippee-Mis18	3.7e-10	51.3	Yippee zinc-binding/DNA-binding /Mis18, centromere assembly

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 482537.XP_008578154.1

Rank	PPI partner	STRING score	Description
1	482537.XP_008579569.1	0.823	WD repeat-containing protein 26 isoform X1
2	482537.XP_008570382.1	0.699	Macoilin isoform X1
3	482537.XP_008565461.1	0.672	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 3 mRNAs, 6 Proteins, and 99% coverage of the annotated genomic feature by RNAseq alignments, including 2 samples with support for all annotated introns
4	482537.XP_008565700.1	0.669	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 22 Proteins, and 99% coverage of the annotated genomic feature by RNAseq alignments, including 2 samples with support for all annotated introns
5	482537.XP_008565952.1	0.668	Complement C1q-like protein 3
6	482537.XP_008581620.1	0.668	Complement C1q-like protein 2
7	482537.XP_008580953.1	0.667	Complement C1q-like protein 4
8	482537.XP_008574811.1	0.617	Calcium-binding mitochondrial carrier protein Aralar1 isoform X1
9	482537.XP_008567446.1	0.603	Macrophage erythroblast attacher
10	482537.XP_008573528.1	0.597	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 2 mRNAs, 8 Proteins, and 92% coverage of the annotated genomic feature by RNAseq alignments
11	482537.XP_008566688.1	0.578	Leucine carboxyl methyltransferase 1
12	482537.XP_008588141.1	0.566	Armadillo repeat-containing protein 8
13	482537.XP_008590603.1	0.566	Armadillo repeat-containing protein 8 isoform X1
14	482537.XP_008580104.1	0.561	Fibronectin type III domain-containing protein 5 isoform X1
15	482537.XP_008582918.1	0.534	Vang-like protein 2
16	482537.XP_008569264.1	0.505	Ran-binding protein 9

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.995	regulation of biological process
GO:0050794	0.994	regulation of cellular process
GO:0009987	0.966	cellular process
GO:0048519	0.804	negative regulation of biological process
GO:0051179	0.545	localization
GO:0045595	0.503	regulation of cell differentiation
GO:0051641	0.491	cellular localization
GO:0048523	0.488	negative regulation of cellular process
GO:0051239	0.474	regulation of multicellular organismal process
GO:0022603	0.419	regulation of anatomical structure morphogenesis
GO:0022604	0.412	regulation of cell morphogenesis
GO:0002682	0.408	regulation of immune system process
GO:0060284	0.403	regulation of cell development
GO:2000026	0.387	regulation of multicellular organismal development
GO:0008360	0.384	regulation of cell shape
GO:0045637	0.331	regulation of myeloid cell differentiation
GO:0019222	0.318	regulation of metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005622	0.997	intracellular anatomical structure
GO:0016020	0.986	membrane
GO:0043226	0.977	organelle
GO:0070013	0.972	intracellular organelle lumen
GO:0043227	0.955	membrane-bounded organelle
GO:0005737	0.953	cytoplasm
GO:0043231	0.927	intracellular membrane-bounded organelle
GO:0031981	0.921	nuclear lumen
GO:0005654	0.550	nucleoplasm
GO:0043232	0.489	intracellular non-membrane-bounded organelle
GO:0032991	0.478	protein-containing complex
GO:0012505	0.421	endomembrane system
GO:0005829	0.393	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]