StarFunc result for job id Q96NS5

User Input

>input (453 residues)
MARETFPFTSSMLRSLRLQQEWLEWEDRRRAAAQQCRSRRCPSSPRARLTRPHRSCRDPA
VHQALFSGNLQQVQALFQDEEAANMIVETVSNQLAWSAEQGFWVLTPKTKQTAPLAIATA
RGYTDCARHLIRQGAELDARVGGRAALHEACARAQFDCVRLLLTFGAKANVLTEEGTTPL
HLCTIPESLQCAKLLLEAGATVNLAAGESQETPLHVAAARGLEQHVALYLEHGADVGLRT
SQGETALNTACAGAEGPGSCRRHQAAARRLLEAGADARAAGRKRHTPLHNACANGCGGLA
ELLLRYGARAEVPNGAGHTPMDCALQAVQDSPNWEPEVLFAALLDYGAQPVRPEMLKHCA
NFPRALEVLLNAYPCVPSCETWVEAVLPELWKEHEAFYSSALCMVNQPRQLQHLARLAVR
ARLGSRCRQGATRLPLPPLLRDYLLLRVEGCIQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q96NS5	1.000	1.000	1.023E-68	453	1.000	1.000	Q96NS5.pdb.gz	ASB16_HUMAN Ankyrin repeat and SOCS box protein 16 OS=Homo sapiens OX=9606 GN=ASB16 PE=1 SV=2
2	AFDB:Q6ZVZ8	0.802	0.781	1.685E-29	466	0.358	0.348	Q6ZVZ8.pdb.gz	ASB18_HUMAN Ankyrin repeat and SOCS box protein 18 OS=Homo sapiens OX=9606 GN=ASB18 PE=2 SV=2
3	AFDB:Q8WXI3	0.806	0.783	1.830E-28	467	0.358	0.347	Q8WXI3.pdb.gz	ASB10_HUMAN Ankyrin repeat and SOCS box protein 10 OS=Homo sapiens OX=9606 GN=ASB10 PE=1 SV=2
4	AFDB:Q9WV71	0.773	0.820	1.724E-25	426	0.287	0.305	Q9WV71.pdb.gz	ASB4_MOUSE Ankyrin repeat and SOCS box protein 4 OS=Mus musculus OX=10090 GN=Asb4 PE=1 SV=1
5	AFDB:A0A0R4IA11	0.462	0.381	3.153E-14	563	0.254	0.204	A0A0R4IA11.pdb.gz
6	AFDB:Q9Y575	0.465	0.409	4.110E-14	518	0.227	0.199	Q9Y575.pdb.gz	ASB3_HUMAN Ankyrin repeat and SOCS box protein 3 OS=Homo sapiens OX=9606 GN=ASB3 PE=1 SV=1
7	AFDB:Q8N8A2	0.519	0.249	1.480E-13	993	0.205	0.094	Q8N8A2.pdb.gz	ANR44_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Homo sapiens OX=9606 GN=ANKRD44 PE=1 SV=3
8	AFDB:Q96Q27	0.422	0.333	1.846E-13	587	0.234	0.181	Q96Q27.pdb.gz	ASB2_HUMAN Ankyrin repeat and SOCS box protein 2 OS=Homo sapiens OX=9606 GN=ASB2 PE=1 SV=2
9	AFDB:A6NGH8	0.502	0.538	2.515E-13	418	0.194	0.211	A6NGH8.pdb.gz	ANR61_HUMAN Ankyrin repeat domain-containing protein 61 OS=Homo sapiens OX=9606 GN=ANKRD61 PE=4 SV=2
10	AFDB:Q3UES3	0.268	0.108	2.747E-13	1166	0.212	0.082	Q3UES3.pdb.gz	TNKS2_MOUSE Poly [ADP-ribose] polymerase tankyrase-2 OS=Mus musculus OX=10090 GN=Tnks2 PE=2 SV=2
11	PDB:8cs9A	0.523	0.313	1.807E-12	796	0.234	0.133	8cs9A.pdb.gz	Architecture of the human erythrocyte ankyrin-1 complex.
12	PDB:6v9hC	0.420	0.684	2.448E-11	270	0.190	0.319	6v9hC.pdb.gz
13	PDB:5vkqA	0.399	0.147	3.605E-9	1499	0.163	0.049	5vkqA.pdb.gz
14	PDB:4oauC	0.519	0.350	6.994E-9	692	0.161	0.105	4oauC.pdb.gz	Structure of human RNase L reveals the basis for regulated RNA decay in the IFN response.
15	PDB:6aunA	0.424	0.321	1.619E-8	618	0.132	0.097	6aunA.pdb.gz
16	PDB:2dvwA	0.423	0.819	1.932E-8	229	0.124	0.245	2dvwA.pdb.gz
17	PDB:1wg0A	0.412	0.740	9.853E-7	243	0.110	0.206	1wg0A.pdb.gz
18	PDB:6jd6B	0.326	0.737	1.284E-6	192	0.102	0.240	6jd6B.pdb.gz
19	PDB:6mwqA	0.283	0.263	1.593E-5	493	0.135	0.124	6mwqA.pdb.gz
20	PDB:1bd8A	0.305	0.831	1.665E-5	156	0.104	0.301	1bd8A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q96NS5	0.0	913	453	1.000	1.000	ASB16_HUMAN Ankyrin repeat and SOCS box protein 16 OS=Homo sapiens OX=9606 GN=ASB16 PE=1 SV=2
2	Q6ZVZ8	3.66e-81	260	466	0.369	0.358	ASB18_HUMAN Ankyrin repeat and SOCS box protein 18 OS=Homo sapiens OX=9606 GN=ASB18 PE=2 SV=2
3	Q8WXI3	2.93e-56	195	467	0.327	0.317	ASB10_HUMAN Ankyrin repeat and SOCS box protein 10 OS=Homo sapiens OX=9606 GN=ASB10 PE=1 SV=2
4	Q9Y574	3.09e-55	191	426	0.296	0.315	ASB4_HUMAN Ankyrin repeat and SOCS box protein 4 OS=Homo sapiens OX=9606 GN=ASB4 PE=1 SV=1
5	Q9WV71	2.86e-52	183	426	0.272	0.289	ASB4_MOUSE Ankyrin repeat and SOCS box protein 4 OS=Mus musculus OX=10090 GN=Asb4 PE=1 SV=1
6	M9MRX4	4.93e-24	108	13559	0.170	0.006	M9MRX4_DROME Ankyrin 2, isoform U OS=Drosophila melanogaster OX=7227 GN=Ank2 PE=1 SV=1
7	X2JCM1	4.99e-24	108	11634	0.170	0.007	X2JCM1_DROME Ankyrin 2, isoform AA OS=Drosophila melanogaster OX=7227 GN=Ank2 PE=1 SV=1
8	M9MSK6	2.20e-23	106	4352	0.170	0.018	M9MSK6_DROME Ankyrin 2, isoform Q OS=Drosophila melanogaster OX=7227 GN=Ank2 PE=1 SV=1
9	M9MRR4	2.52e-23	106	4223	0.170	0.018	M9MRR4_DROME Ankyrin 2, isoform T OS=Drosophila melanogaster OX=7227 GN=Ank2 PE=1 SV=1
10	M9MS19	2.52e-23	106	4230	0.170	0.018	M9MS19_DROME Ankyrin 2, isoform P OS=Drosophila melanogaster OX=7227 GN=Ank2 PE=1 SV=1
11	A8JNM7	2.53e-23	106	4114	0.170	0.019	A8JNM7_DROME Ankyrin 2, isoform F OS=Drosophila melanogaster OX=7227 GN=Ank2 PE=1 SV=1
12	M9MRX1	2.55e-23	106	4329	0.170	0.018	M9MRX1_DROME Ankyrin 2, isoform S OS=Drosophila melanogaster OX=7227 GN=Ank2 PE=1 SV=1
13	A8JNM6	2.99e-23	105	4189	0.170	0.018	A8JNM6_DROME Ankyrin 2, isoform J OS=Drosophila melanogaster OX=7227 GN=Ank2 PE=1 SV=1
14	Q7KU92	3.32e-23	105	4083	0.170	0.019	Q7KU92_DROME Ankyrin 2, isoform L OS=Drosophila melanogaster OX=7227 GN=Ank2 PE=1 SV=2
15	M9MRS5	3.35e-23	105	4496	0.170	0.017	M9MRS5_DROME Ankyrin 2, isoform R OS=Drosophila melanogaster OX=7227 GN=Ank2 PE=1 SV=1
16	A8JNM5	3.46e-23	105	4264	0.170	0.018	A8JNM5_DROME Ankyrin 2, isoform K OS=Drosophila melanogaster OX=7227 GN=Ank2 PE=1 SV=1
17	X2JC49	3.55e-23	105	4233	0.170	0.018	X2JC49_DROME Ankyrin 2, isoform Z OS=Drosophila melanogaster OX=7227 GN=Ank2 PE=1 SV=1
18	M9PEN3	3.63e-23	105	4373	0.170	0.018	M9PEN3_DROME Ankyrin 2, isoform V OS=Drosophila melanogaster OX=7227 GN=Ank2 PE=1 SV=1
19	X2JGD3	3.78e-23	105	2566	0.170	0.030	X2JGD3_DROME Ankyrin 2, isoform Y OS=Drosophila melanogaster OX=7227 GN=Ank2 PE=1 SV=1
20	A8JNM4	5.22e-23	105	2532	0.170	0.030	A8JNM4_DROME Ankyrin 2, isoform G OS=Drosophila melanogaster OX=7227 GN=Ank2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00023 Ank	2.1e-13	61.3	Ankyrin repeat
2	PF12796 Ank_2	1.1e-41	152.6	Ankyrin repeats (3 copies)
3	PF13606 Ank_3	2.2e-14	63.0	Ankyrin repeat
4	PF13637 Ank_4	1.8e-17	74.7	Ankyrin repeats (many copies)
5	PF13857 Ank_5	5.5e-17	72.9	Ankyrin repeats (many copies)
6	PF07525 SOCS_box	2.6e-06	39.0	SOCS box

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000293414

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000269097	0.710	Glucose-6-phosphatase 3
2	9606.ENSP00000313500	0.689	Uncharacterized protein C17orf53
3	9606.ENSP00000478121	0.678	Elongin-C
4	9606.ENSP00000376808	0.677	Cullin-5
5	9606.ENSP00000250495	0.650	NEDD8
6	9606.ENSP00000285407	0.626	Krueppel-like factor 10
7	9606.ENSP00000262306	0.625	Elongin-B
8	9606.ENSP00000216252	0.601	PHD finger-like domain-containing protein 5A
9	9606.ENSP00000263401	0.600	COMM domain-containing protein 9
10	9606.ENSP00000267935	0.600	COMM domain-containing protein 4
11	9606.ENSP00000274458	0.600	COMM domain-containing protein 10
12	9606.ENSP00000278980	0.600	COMM domain-containing protein 7
13	9606.ENSP00000308236	0.600	COMM domain-containing protein 1
14	9606.ENSP00000348054	0.600	COMM domain containing 6
15	9606.ENSP00000365401	0.600	Coiled-coil domain-containing protein 22
16	9606.ENSP00000366032	0.600	COMM domain-containing protein 3
17	9606.ENSP00000370984	0.600	COMM domain-containing protein 8
18	9606.ENSP00000394331	0.600	COMM domain-containing protein 5
19	9606.ENSP00000419475	0.600	COMM domain-containing protein 2
20	9606.ENSP00000273480	0.536	RING-box protein 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.991	cellular process
GO:0071704	0.981	organic substance metabolic process
GO:0044238	0.976	primary metabolic process
GO:0006807	0.963	nitrogen compound metabolic process
GO:0043170	0.926	macromolecule metabolic process
GO:0016567	0.832	protein ubiquitination
GO:0065007	0.829	biological regulation
GO:0050789	0.819	regulation of biological process
GO:0050794	0.725	regulation of cellular process
GO:0044237	0.498	cellular metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0043229	0.963	intracellular organelle
GO:0043227	0.940	membrane-bounded organelle
GO:0043231	0.930	intracellular membrane-bounded organelle
GO:0005634	0.843	nucleus
GO:0070013	0.330	intracellular organelle lumen
GO:0031981	0.323	nuclear lumen
GO:0005654	0.302	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]