StarFunc result for job id Q96NS8

User Input

>input (147 residues)
MFLNGNCLETLKKKEPEGGRRRLSHPGNMGWMRPSQETTPPDRSHHSGFGLFCGDPGPEI
EPFSLWVFPQEMVLEIHQLFMDHEYPCHHITSHCTWVAAHWTTSQSCAAWQGCRRACCST
WWKSPAQCTRPTVMSATFETAQEPGPS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q96NS8	1.000	1.000	5.925E-28	147	1.000	1.000	Q96NS8.pdb.gz	CLUP3_HUMAN Putative protein CLUHP3 OS=Homo sapiens OX=9606 GN=CLUHP3 PE=5 SV=1
2	AFDB:O13005	0.167	0.142	2.174E-1	193	0.177	0.135	O13005.pdb.gz	O13005_CHICK Nkx2-8 protein OS=Gallus gallus OX=9031 GN=Nkx2-8 PE=2 SV=1
3	AFDB:Q06AD2	0.162	0.147	2.843E-1	164	0.170	0.152	Q06AD2.pdb.gz
4	AFDB:F1R2J1	0.165	0.138	7.271E-1	182	0.150	0.121	F1R2J1.pdb.gz	PNX_DANRE Homeobox protein pnx OS=Danio rerio OX=7955 GN=pnx PE=1 SV=1
5	AFDB:Q2M1V0	0.175	0.119	7.775E-1	245	0.197	0.118	Q2M1V0.pdb.gz	ISX_HUMAN Intestine-specific homeobox OS=Homo sapiens OX=9606 GN=ISX PE=1 SV=2
6	AFDB:O22173	0.181	0.057	9.508E-1	662	0.170	0.038	O22173.pdb.gz	PABP4_ARATH Polyadenylate-binding protein 4 OS=Arabidopsis thaliana OX=3702 GN=PAB4 PE=1 SV=1
7	AFDB:Q8JIZ3	0.165	0.098	9.508E-1	281	0.156	0.082	Q8JIZ3.pdb.gz	Q8JIZ3_DANRE Cone-rod homeobox OS=Danio rerio OX=7955 GN=crx PE=2 SV=1
8	AFDB:F4J078	0.148	0.167	1.422	125	0.122	0.144	F4J078.pdb.gz	JAZ13_ARATH Protein JAZ13 OS=Arabidopsis thaliana OX=3702 GN=JAZ13 PE=1 SV=1
9	AFDB:P22711	0.169	0.085	1.626	416	0.156	0.055	P22711.pdb.gz	TIN_DROME Muscle-specific homeobox protein tinman OS=Drosophila melanogaster OX=7227 GN=tin PE=2 SV=2
10	AFDB:B0S5T0	0.165	0.100	1.739	285	0.156	0.081	B0S5T0.pdb.gz	B0S5T0_DANRE Short stature homeobox OS=Danio rerio OX=7955 GN=si:ch211-134k13.1 PE=4 SV=1
11	PDB:7enaq	0.137	0.051	2.158	555	0.082	0.022	7enaq.pdb.gz	Structures of the human Mediator and Mediator-bound preinitiation complex.
12	PDB:6fo1A	0.226	0.122	2.639	323	0.054	0.025	6fo1A.pdb.gz	RPAP3 provides a flexible scaffold for coupling HSP90 to the human R2TP co-chaperone complex.
13	PDB:6ybwz	0.227	0.209	3.691	160	0.020	0.019	6ybwz.pdb.gz	Structure of a human 48Stranslational initiation complex.
14	PDB:7oleC	0.212	0.094	5.519	427	0.061	0.021	7oleC.pdb.gz	Structure of the TELO2-TTI1-TTI2 complex and its function in TOR recruitment to the R2TP chaperone.
15	PDB:6htsE	0.188	0.077	5.902	443	0.054	0.018	6htsE.pdb.gz	Structure and regulation of the human INO80-nucleosome complex.
16	PDB:6igmC	0.232	0.114	6.311	370	0.054	0.022	6igmC.pdb.gz
17	PDB:3j7aU	0.147	0.145	6.749	149	0.068	0.067	3j7aU.pdb.gz	Cryo-EM structure of the Plasmodium falciparum 80S ribosome bound to the anti-protozoan drug emetine.
18	PDB:8escE	0.144	0.057	6.749	440	0.082	0.027	8escE.pdb.gz	Structure and flexibility of the yeast NuA4 histone acetyltransferase complex.
19	PDB:1v74B	0.213	0.314	7.217	87	0.020	0.034	1v74B.pdb.gz
20	PDB:5im3A	0.153	0.039	7.217	874	0.075	0.013	5im3A.pdb.gz	Structural Mechanism of Allosteric Activity Regulation in a Ribonucleotide Reductase with Double ATP Cones.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q96NS8	2.20e-108	306	147	1.000	1.000	CLUP3_HUMAN Putative protein CLUHP3 OS=Homo sapiens OX=9606 GN=CLUHP3 PE=5 SV=1
2	O75153	1.43e-10	60.5	1309	0.293	0.033	CLU_HUMAN Clustered mitochondria protein homolog OS=Homo sapiens OX=9606 GN=CLUH PE=1 SV=2
3	A1ZAB5	1.4	31.2	1448	0.082	0.008	CLU_DROME Protein clueless OS=Drosophila melanogaster OX=7227 GN=clu PE=1 SV=1
4	A0A0S2Z5Q7	6.2	29.3	812	0.082	0.015	A0A0S2Z5Q7_HUMAN Alsin Rho guanine nucleotide exchange factor ALS2 (Fragment) OS=Homo sapiens OX=9606 GN=ALS2 PE=1 SV=1
5	P0C5Y8	9.7	28.9	1651	0.082	0.007	ALS2_RAT Alsin OS=Rattus norvegicus OX=10116 GN=Als2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 34839.XP_005402629.1

Rank	PPI partner	STRING score	Description
1	34839.XP_005405225.1	0.866	Eukaryotic translation initiation factor 3 subunit C-like
2	34839.XP_005387940.1	0.821	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 13 mRNAs, 8 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 13 samples with support for all annotated introns
3	34839.XP_005397937.1	0.785	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 18 mRNAs, 7 Proteins, and 98% coverage of the annotated genomic feature by RNAseq alignments, including 14 samples with support for all annotated introns
4	34839.XP_005393161.1	0.767	Elongation factor G, mitochondrial
5	34839.XP_005405637.1	0.753	Eukaryotic translation initiation factor 3 subunit G
6	34839.XP_005405011.1	0.687	Mitochondrial import receptor subunit TOM20 homolog
7	34839.XP_005412605.1	0.650	relA-associated inhibitor
8	34839.XP_005402640.1	0.644	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 8 mRNAs, 4 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 6 samples with support for all annotated introns
9	34839.XP_005405224.1	0.640	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 8 mRNAs, 5 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 13 samples with support for all annotated introns
10	34839.XP_005378164.1	0.630	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 12 mRNAs, 8 Proteins, and 98% coverage of the annotated genomic feature by RNAseq alignments, including 13 samples with support for all annotated introns
11	34839.XP_005395112.1	0.629	Eukaryotic translation initiation factor 3 subunit I
12	34839.XP_005386663.1	0.627	Mitochondrial import receptor subunit TOM70
13	34839.XP_005379509.1	0.591	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 8 mRNAs, 6 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 13 samples with support for all annotated introns
14	34839.XP_005388565.1	0.584	Aspartate aminotransferase, mitochondrial
15	34839.XP_005381750.1	0.577	Eukaryotic translation initiation factor 3 subunit J
16	34839.XP_005381738.1	0.545	Mitochondrial import receptor subunit TOM20 homolog
17	34839.XP_005373807.1	0.542	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 mRNA, 2 ESTs, 5 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 14 samples with support for all annotated introns
18	34839.XP_005377890.1	0.539	Uncharacterized protein C6orf203 homolog isoform X1
19	34839.XP_005412534.1	0.514	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 4 mRNAs, 13 Proteins, and 96% coverage of the annotated genomic feature by RNAseq alignments
20	34839.XP_005411672.1	0.502	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 8 mRNAs, 4 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 13 samples with support for all annotated introns

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050789	0.428	regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005622	0.999	intracellular anatomical structure
GO:0005737	0.986	cytoplasm
GO:0071944	0.399	cell periphery
GO:0005886	0.389	plasma membrane
GO:0043226	0.315	organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]