StarFunc result for job id Q96NU0

User Input

>input (1288 residues)
MASVAWAVLKVLLLLPTQTWSPVGAGNPPDCDSPLASALPRSSFSSSSELSSSHGPGFSR
LNRRDGAGGWTPLVSNKYQWLQIDLGERMEVTAVATQGGYGSSDWVTSYLLMFSDGGRNW
KQYRREESIWGFPGNTNADSVVHYRLQPPFEARFLRFLPLAWNPRGRIGMRIEVYGCAYK
SEVVYFDGQSALLYTLDKKPLKPIRDVISLKFKAMQSNGILLHREGQHGNHITLELIKGK
LVFFLNSGNAKLPSTIAPVTLTLGSLLDDQHWHSVLIELLDTQVNFTVDKHTHHFQAKGD
SSNLDLNFEISFGGILSPGRSRAFTRKSFHGCLENLYYNGVDVTELAKKHKPQILMMGNV
SFSCPQPQTVPVTFLSSRSYLALPGNSGEDKVSVTFQFRTWNRAGHLLFGELQRGSGSFV
LFLKDGKLKLSLFQAGQSPRNVTAGAGLNDGQWHSVSFSAKWSHMNVVVDDDTAVQPLVA
VLIDSGDTYYFGGCLGNSSGSGCKSPLGGFQGCLRLITIGDKAVDPILVQQGALGSFRDL
QIDSCGITDRCLPSYCEHGGECSQSWDTFSCDCLGTGYTGETCHSSLYEQSCEAHKHRGN
PSGLYYIDADGSGPLGPFLVYCNMTADSAWTVVRHGGPDAVTLRGAPSGHPLSAVSFAYA
AGAGQLRAAVNLAERCEQRLALRCGTARRPDSRDGTPLSWWVGRTNETHTSWGGSLPDAQ
KCTCGLEGNCIDSQYYCNCDAGQNEWTSDTIVLSQKEHLPVTQIVMTDTGQPHSEADYTL
GPLLCRGDKSFWNSASFNTETSYLHFPAFHGELTADVCFFFKTTVSSGVFMENLGITDFI
RIELRAPTEVTFSFDVGNGPCEVTVQSPTPFNDNQWHHVRAERNVKGASLQVDQLPQKMQ
PAPADGHVRLQLNSQLFIGGTATRQRGFLGCIRSLQLNGVALDLEERATVTPGVEPGCAG
HCSTYGHLCRNGGRCREKRRGVTCDCAFSAYDGPFCSNEISAYFATGSSMTYHFQEHYTL
SENSSSLVSSLHRDVTLTREMITLSFRTTRTPSLLLYVSSFYEEYLSVILANNGSLQIRY
KLDRHQNPDAFTFDFKNMADGQLHQVKINREEAVVMVEVNQSAKKQVILSSGTEFNAVKS
LILGKVLEAAGADPDTRRAATSGFTGCLSAVRFGCAAPLKAALRPSGPSRVTVRGHVAPM
ARCAAGAASGSPARELAPRLAGGAGRSGPVDEGEPLVNADRRDSAVIGGVIAVEIFILLC
ITAIAIRIYQQRKLRKENESKVSKKEEC

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:E9PY62	0.949	0.950	0.000	1287	0.730	0.730	E9PY62.pdb.gz	E9PY62_MOUSE Contactin associated protein-like 3 OS=Mus musculus OX=10090 GN=Cntnap3 PE=1 SV=1
2	AFDB:O54991	0.671	0.626	0.000	1385	0.371	0.345	O54991.pdb.gz	CNTP1_MOUSE Contactin-associated protein 1 OS=Mus musculus OX=10090 GN=Cntnap1 PE=1 SV=2
3	AFDB:Q94887	0.638	0.640	0.000	1284	0.300	0.301	Q94887.pdb.gz	NRX4_DROME Neurexin-4 OS=Drosophila melanogaster OX=7227 GN=Nrx-IV PE=1 SV=2
4	AFDB:Q99P47	0.913	0.898	0.000	1310	0.678	0.666	Q99P47.pdb.gz	CNTP4_MOUSE Contactin-associated protein-like 4 OS=Mus musculus OX=10090 GN=Cntnap4 PE=1 SV=2
5	AFDB:Q9C0A0	0.904	0.890	0.000	1308	0.697	0.687	Q9C0A0.pdb.gz	CNTP4_HUMAN Contactin-associated protein-like 4 OS=Homo sapiens OX=9606 GN=CNTNAP4 PE=1 SV=3
6	AFDB:Q9CPW0	0.878	0.850	0.000	1332	0.472	0.456	Q9CPW0.pdb.gz	CNTP2_MOUSE Contactin-associated protein-like 2 OS=Mus musculus OX=10090 GN=Cntnap2 PE=1 SV=2
7	AFDB:Q19617	0.518	0.561	3.697E-71	1180	0.201	0.219	Q19617.pdb.gz	NLR1_CAEEL Neurexin like receptor 1 OS=Caenorhabditis elegans OX=6239 GN=nlr-1 PE=1 SV=3
8	AFDB:M9PE65	0.338	0.226	7.517E-70	2179	0.221	0.131	M9PE65.pdb.gz	AXO_DROME Axotactin OS=Drosophila melanogaster OX=7227 GN=axo PE=1 SV=1
9	AFDB:Q6P9K9	0.180	0.152	4.509E-61	1571	0.207	0.169	Q6P9K9.pdb.gz	NRX3A_MOUSE Neurexin-3 OS=Mus musculus OX=10090 GN=Nrxn3 PE=1 SV=2
10	AFDB:B7ZD56	0.177	0.142	1.191E-60	1670	0.203	0.156	B7ZD56.pdb.gz
11	PDB:4bxsV	0.108	0.110	2.442E-8	1262	0.043	0.044	4bxsV.pdb.gz	Crystal Structure of the Prothrombinase Complex from the Venom of Pseudonaja Textilis.
12	PDB:7kveB	0.110	0.103	6.146E-8	1374	0.040	0.038	7kveB.pdb.gz
13	PDB:2vmeA	0.101	0.482	1.156E-7	256	0.040	0.199	2vmeA.pdb.gz	Structure Determination of Discoidin II from Dictyostelium Discoideum and Carbohydrate Binding Properties of the Lectin Domain.
14	PDB:2w94A	0.108	0.514	1.312E-6	254	0.043	0.217	2w94A.pdb.gz	Discoidin I from Dictyostelium Discoideum and Interactions with Oligosaccharides: Specificity, Affinity, Crystal Structures and Comparison with Discoidin II.
15	PDB:3v0aB	0.111	0.122	4.011E-6	1150	0.030	0.034	3v0aB.pdb.gz	Botulinum neurotoxin is shielded by NTNHA in an interlocked complex.
16	PDB:3jd6O	0.109	0.774	5.369E-6	167	0.035	0.269	3jd6O.pdb.gz
17	PDB:7zl1A	0.104	0.526	8.314E-6	215	0.025	0.149	7zl1A.pdb.gz
18	PDB:2a3wA	0.114	0.611	1.287E-5	204	0.023	0.147	2a3wA.pdb.gz	Ligand-assisted Aggregation of Proteins: DIMERIZATION OF SERUM AMYLOID P COMPONENT BY BIVALENT LIGANDS.
19	PDB:6m5yA	0.080	0.327	1.351E-5	270	0.026	0.122	6m5yA.pdb.gz	Crystal structure and conformational stability of a galectin-1 tandem-repeat mutant with a short linker.
20	PDB:3ffzA	0.089	0.092	1.641E-5	1246	0.026	0.027	3ffzA.pdb.gz	Domain organization in Clostridium botulinum neurotoxin type E is unique: its implication in faster translocation.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A8I6GH02	0.0	1208	1332	0.474	0.458	A0A8I6GH02_RAT Contactin associated protein 2 OS=Rattus norvegicus OX=10116 GN=Cntnap2 PE=3 SV=1
2	D8WUA6	0.0	1215	1328	0.470	0.456	D8WUA6_TAEGU Contactin associated protein-like 2 OS=Taeniopygia guttata OX=59729 GN=CNTNAP2 PE=2 SV=1
3	E9PY62	0.0	1946	1287	0.730	0.730	E9PY62_MOUSE Contactin associated protein-like 3 OS=Mus musculus OX=10090 GN=Cntnap3 PE=1 SV=1
4	O54991	0.0	887	1385	0.356	0.331	CNTP1_MOUSE Contactin-associated protein 1 OS=Mus musculus OX=10090 GN=Cntnap1 PE=1 SV=2
5	P78357	0.0	890	1384	0.354	0.329	CNTP1_HUMAN Contactin-associated protein 1 OS=Homo sapiens OX=9606 GN=CNTNAP1 PE=1 SV=1
6	P97846	0.0	885	1381	0.358	0.334	CNTP1_RAT Contactin-associated protein 1 OS=Rattus norvegicus OX=10116 GN=Cntnap1 PE=1 SV=1
7	Q3URC6	0.0	788	510	0.293	0.741	Q3URC6_MOUSE Uncharacterized protein (Fragment) OS=Mus musculus OX=10090 GN=Cntnap3 PE=2 SV=1
8	Q94887	0.0	585	1284	0.297	0.298	NRX4_DROME Neurexin-4 OS=Drosophila melanogaster OX=7227 GN=Nrx-IV PE=1 SV=2
9	Q99P47	0.0	1781	1310	0.679	0.668	CNTP4_MOUSE Contactin-associated protein-like 4 OS=Mus musculus OX=10090 GN=Cntnap4 PE=1 SV=2
10	Q9C0A0	0.0	1855	1308	0.699	0.688	CNTP4_HUMAN Contactin-associated protein-like 4 OS=Homo sapiens OX=9606 GN=CNTNAP4 PE=1 SV=3
11	Q9CPW0	0.0	1205	1332	0.474	0.458	CNTP2_MOUSE Contactin-associated protein-like 2 OS=Mus musculus OX=10090 GN=Cntnap2 PE=1 SV=2
12	Q9UHC6	0.0	1207	1331	0.469	0.454	CNTP2_HUMAN Contactin-associated protein-like 2 OS=Homo sapiens OX=9606 GN=CNTNAP2 PE=1 SV=1
13	M9PE65	1.35e-61	234	2179	0.176	0.104	AXO_DROME Axotactin OS=Drosophila melanogaster OX=7227 GN=axo PE=1 SV=1
14	A0A0R4J2G7	4.76e-59	226	1495	0.196	0.169	A0A0R4J2G7_HUMAN Neurexin 1 OS=Homo sapiens OX=9606 GN=NRXN1 PE=1 SV=1
15	A0A1D5RMU6	4.87e-59	226	1499	0.196	0.169	A0A1D5RMU6_HUMAN Neurexin 1 OS=Homo sapiens OX=9606 GN=NRXN1 PE=1 SV=1
16	Q28146	9.87e-58	222	1530	0.196	0.165	NRX1A_BOVIN Neurexin-1 OS=Bos taurus OX=9913 GN=NRXN1 PE=1 SV=1
17	Q9ULB1	1.18e-57	221	1477	0.201	0.175	NRX1A_HUMAN Neurexin-1 OS=Homo sapiens OX=9606 GN=NRXN1 PE=1 SV=1
18	Q9CS84	1.70e-57	221	1514	0.196	0.167	NRX1A_MOUSE Neurexin-1 OS=Mus musculus OX=10090 GN=Nrxn1 PE=1 SV=3
19	E7ERL8	4.11e-57	219	1507	0.196	0.167	E7ERL8_HUMAN Neurexin 1 OS=Homo sapiens OX=9606 GN=NRXN1 PE=1 SV=1
20	Q63372	6.05e-57	219	1530	0.196	0.165	NRX1A_RAT Neurexin-1 OS=Rattus norvegicus OX=10116 GN=Nrxn1 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01410 COLFI	5.9	17.7	Fibrillar collagen C-terminal domain
2	PF00008 EGF	0.055	25.1	EGF-like domain
3	PF00754 F5_F8_type_C	1.4e-24	98.0	F5/8 type C domain
4	PF00147 Fibrinogen_C	2.8e+02	12.7	Fibrinogen beta and gamma chains, C-terminal globular domain
5	PF00054 Laminin_G_1	6.9e-52	186.5	Laminin G domain
6	PF02210 Laminin_G_2	2e-81	282.2	Laminin G domain
7	PF13385 Laminin_G_3	2.2e-07	42.6	Concanavalin A-like lectin/glucanases superfamily

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000478671

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000345259	0.657	Protein 4.1
2	9606.ENSP00000440504	0.599	Uncharacterized protein KIAA1958
3	9606.ENSP00000485118	0.595	Spermatogenesis-associated protein 31A3
4	9606.ENSP00000344786	0.524	Neurofascin
5	9606.ENSP00000392500	0.521	Neuroligin-1
6	9606.ENSP00000328054	0.517	Putative coiled-coil domain-containing protein 144 N-terminal-like
7	9606.ENSP00000265381	0.514	Amyloid-beta A4 precursor protein-binding family A member 1
8	9606.ENSP00000484228	0.505	All-trans retinoic acid-induced differentiation factor

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0019904	0.566	protein domain specific binding
GO:0030165	0.455	PDZ domain binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.991	cellular process
GO:0050794	0.986	regulation of cellular process
GO:0032501	0.981	multicellular organismal process
GO:0007275	0.961	multicellular organism development
GO:0048731	0.932	system development
GO:0007399	0.782	nervous system development
GO:0071840	0.569	cellular component organization or biogenesis
GO:0016043	0.554	cellular component organization
GO:0050896	0.409	response to stimulus
GO:0023051	0.383	regulation of signaling
GO:0010646	0.381	regulation of cell communication
GO:0030154	0.327	cell differentiation
GO:0007154	0.322	cell communication
GO:0048518	0.315	positive regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043005	0.995	neuron projection
GO:0016020	0.991	membrane
GO:0036477	0.989	somatodendritic compartment
GO:0005886	0.984	plasma membrane
GO:0030054	0.841	cell junction
GO:0098590	0.820	plasma membrane region
GO:0045202	0.805	synapse
GO:0030424	0.679	axon
GO:0097060	0.668	synaptic membrane
GO:0005622	0.410	intracellular anatomical structure
GO:0043226	0.393	organelle
GO:0044297	0.376	cell body
GO:0043025	0.362	neuronal cell body
GO:0043231	0.348	intracellular membrane-bounded organelle
GO:0005737	0.319	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]