StarFunc result for job id Q96NW4

User Input

>input (1050 residues)
MALYDEDLLKNPFYLALQKCRPDLCSKVAQIHGIVLVPCKGSLSSSIQSTCQFESYILIP
VEEHFQTLNGKDVFIQGNRIKLGAGFACLLSVPILFEETFYNEKEESFSILCIAHPLEKR
ESSEEPLAPSDPFSLKTIEDVREFLGRHSERFDRNIASFHRTFRECERKSLRHHIDSANA
LYTKCLQQLLRDSHLKMLAKQEAQMNLMKQAVEIYVHHEIYNLIFKYVGTMEASEDAAFN
KITRSLQDLQQKDIGVKPEFSFNIPRAKRELAQLNKCTSPQQKLVCLRKVVQLITQSPSQ
RVNLETMCADDLLSVLLYLLVKTEIPNWMANLSYIKNFRFSSLAKDELGYCLTSFEAAIE
YIRQGSLSAKPPESEGFGDRLFLKQRMSLLSQMTSSPTDCLFKHIASGNQKEVERLLSQE
DHDKDTVQKMCHPLCFCDDCEKLVSGRLNDPSVVTPFSRDDRGHTPLHVAAVCGQASLID
LLVSKGAMVNATDYHGATPLHLACQKGYQSVTLLLLHYKASAEVQDNNGNTPLHLACTYG
HEDCVKALVYYDVESCRLDIGNEKGDTPLHIAARWGYQGVIETLLQNGASTEIQNRLKET
PLKCALNSKILSVMEAYHLSFERRQKSSEAPVQSPQRSVDSISQESSTSSFSSMSASSRQ
EETKKDYREVEKLLRAVADGDLEMVRYLLEWTEEDLEDAEDTVSAADPEFCHPLCQCPKC
APAQKRLAKVPASGLGVNVTSQDGSSPLHVAALHGRADLIPLLLKHGANAGARNADQAVP
LHLACQQGHFQVVKCLLDSNAKPNKKDLSGNTPLIYACSGGHHELVALLLQHGASINASN
NKGNTALHEAVIEKHVFVVELLLLHGASVQVLNKRQRTAVDCAEQNSKIMELLQVVPSCV
ASLDDVAETDRKEYVTVKIRKKWNSKLYDLPDEPFTRQFYFVHSAGQFKGKTSREIMARD
RSVPNLTEGSLHEPGRQSVTLRQNNLPAQSGSHAAEKGNSDWPERPGLTQTGPGHRRMLR
RHTVEDAVVSQGPEAAGPLSTPQEVSASRS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A0G2JVS9	0.521	0.519	0.000	1055	0.810	0.807	A0A0G2JVS9.pdb.gz	A0A0G2JVS9_RAT Ankyrin repeat domain 27 OS=Rattus norvegicus OX=10116 GN=Ankrd27 PE=1 SV=2
2	AFDB:A0A0G2K7U7	0.476	0.474	0.000	1054	0.815	0.812	A0A0G2K7U7.pdb.gz	A0A0G2K7U7_RAT Ankyrin repeat domain 27 OS=Rattus norvegicus OX=10116 GN=Ankrd27 PE=1 SV=2
3	AFDB:Q96NW4	1.000	1.000	0.000	1050	1.000	1.000	Q96NW4.pdb.gz	ANR27_HUMAN Ankyrin repeat domain-containing protein 27 OS=Homo sapiens OX=9606 GN=ANKRD27 PE=1 SV=2
4	PDB:8cs9A	0.235	0.294	4.121E-18	796	0.141	0.186	8cs9A.pdb.gz	Architecture of the human erythrocyte ankyrin-1 complex.
5	AFDB:O89019	0.214	0.212	5.964E-17	1062	0.134	0.133	O89019.pdb.gz	INVS_MOUSE Inversin OS=Mus musculus OX=10090 GN=Invs PE=1 SV=2
6	AFDB:A2A690	0.226	0.132	3.530E-14	1994	0.150	0.079	A2A690.pdb.gz	TANC2_MOUSE Protein TANC2 OS=Mus musculus OX=10090 GN=Tanc2 PE=1 SV=1
7	AFDB:Q9VUX2	0.168	0.150	8.504E-14	1226	0.110	0.095	Q9VUX2.pdb.gz	MIB_DROME E3 ubiquitin-protein ligase mind-bomb OS=Drosophila melanogaster OX=7227 GN=mib1 PE=1 SV=3
8	AFDB:Q8R516	0.167	0.177	6.449E-13	973	0.105	0.113	Q8R516.pdb.gz	MIB2_MOUSE E3 ubiquitin-protein ligase MIB2 OS=Mus musculus OX=10090 GN=Mib2 PE=1 SV=2
9	PDB:5vkqA	0.256	0.186	9.483E-13	1499	0.118	0.083	5vkqA.pdb.gz
10	AFDB:Q6NQV8	0.223	0.234	1.511E-9	986	0.101	0.108	Q6NQV8.pdb.gz	Q6NQV8_DROME RH15640p OS=Drosophila melanogaster OX=7227 GN=wtrw PE=2 SV=1
11	AFDB:Q9VUX6	0.106	0.127	1.570E-9	860	0.088	0.107	Q9VUX6.pdb.gz	Q9VUX6_DROME Myosin binding subunit, isoform K OS=Drosophila melanogaster OX=7227 GN=Mbs PE=1 SV=3
12	AFDB:Q9CZK6	0.168	0.267	2.215E-9	655	0.082	0.131	Q9CZK6.pdb.gz	ANKS3_MOUSE Ankyrin repeat and SAM domain-containing protein 3 OS=Mus musculus OX=10090 GN=Anks3 PE=1 SV=2
13	PDB:4oauC	0.163	0.221	3.017E-9	692	0.088	0.133	4oauC.pdb.gz	Structure of human RNase L reveals the basis for regulated RNA decay in the IFN response.
14	PDB:2dvwA	0.178	0.786	9.868E-9	229	0.063	0.288	2dvwA.pdb.gz
15	PDB:1wg0A	0.155	0.615	3.872E-7	243	0.044	0.189	1wg0A.pdb.gz
16	PDB:6aunA	0.159	0.239	4.342E-7	618	0.074	0.126	6aunA.pdb.gz
17	PDB:6v9hC	0.139	0.484	9.690E-7	270	0.050	0.196	6v9hC.pdb.gz
18	PDB:6jd6B	0.157	0.792	1.007E-6	192	0.050	0.276	6jd6B.pdb.gz
19	PDB:6mwqA	0.138	0.289	1.087E-6	493	0.058	0.124	6mwqA.pdb.gz
20	PDB:6pqpA	0.147	0.243	9.976E-6	615	0.059	0.101	6pqpA.pdb.gz	Structural Insights into Electrophile Irritant Sensing by the Human TRPA1 Channel.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0G2JVS9	0.0	1409	997	0.710	0.748	A0A0G2JVS9_RAT Ankyrin repeat domain 27 OS=Rattus norvegicus OX=10116 GN=Ankrd27 PE=1 SV=2
2	A0A0G2K7U7	0.0	1691	1062	0.808	0.798	A0A0G2K7U7_RAT Ankyrin repeat domain 27 OS=Rattus norvegicus OX=10116 GN=Ankrd27 PE=1 SV=2
3	A0A8I5ZNY3	0.0	1611	988	0.762	0.810	A0A8I5ZNY3_RAT Ankyrin repeat domain 27 OS=Rattus norvegicus OX=10116 GN=Ankrd27 PE=1 SV=1
4	K7ELM1	0.0	769	389	0.354	0.956	K7ELM1_HUMAN Ankyrin repeat domain 27 OS=Homo sapiens OX=9606 GN=ANKRD27 PE=1 SV=1
5	Q3UMR0	0.0	1748	1048	0.815	0.817	ANR27_MOUSE Ankyrin repeat domain-containing protein 27 OS=Mus musculus OX=10090 GN=Ankrd27 PE=1 SV=2
6	Q96NW4	0.0	2181	1050	1.000	1.000	ANR27_HUMAN Ankyrin repeat domain-containing protein 27 OS=Homo sapiens OX=9606 GN=ANKRD27 PE=1 SV=2
7	V9GYL8	5.64e-98	307	150	0.143	1.000	V9GYL8_HUMAN Ankyrin repeat domain 27 (Fragment) OS=Homo sapiens OX=9606 GN=ANKRD27 PE=1 SV=1
8	Q0KIE7	3.72e-45	180	1549	0.133	0.090	Q0KIE7_DROME Ankyrin, isoform B OS=Drosophila melanogaster OX=7227 GN=Ank PE=1 SV=1
9	Q24241	4.91e-45	180	1549	0.133	0.090	Q24241_DROME Ankyrin OS=Drosophila melanogaster OX=7227 GN=Ank PE=4 SV=1
10	Q8MQG0	3.63e-42	171	1841	0.123	0.070	Q8MQG0_CAEEL ANK_REP_REGION domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=unc-44 PE=1 SV=1
11	G5ECZ1	4.35e-42	171	1867	0.123	0.069	G5ECZ1_CAEEL AO66 ankyrin OS=Caenorhabditis elegans OX=6239 GN=unc-44 PE=1 SV=1
12	A0A5F9ZI36	2.91e-41	168	1846	0.123	0.070	A0A5F9ZI36_HUMAN Ankyrin 2 OS=Homo sapiens OX=9606 GN=ANK2 PE=1 SV=1
13	A0A5F9ZHE2	3.16e-41	168	1806	0.123	0.071	A0A5F9ZHE2_HUMAN Ankyrin 2 OS=Homo sapiens OX=9606 GN=ANK2 PE=1 SV=1
14	A0A5F9ZHN0	3.20e-41	167	1777	0.123	0.073	A0A5F9ZHN0_HUMAN Ankyrin 2 OS=Homo sapiens OX=9606 GN=ANK2 PE=1 SV=1
15	A0A5F9ZH17	3.53e-41	167	1879	0.123	0.069	A0A5F9ZH17_HUMAN Ankyrin 2 OS=Homo sapiens OX=9606 GN=ANK2 PE=1 SV=1
16	A0A5F9ZHQ3	3.57e-41	167	1838	0.123	0.070	A0A5F9ZHQ3_HUMAN Ankyrin 2 OS=Homo sapiens OX=9606 GN=ANK2 PE=1 SV=1
17	A0A5F9ZI08	3.64e-41	167	1797	0.123	0.072	A0A5F9ZI08_HUMAN Ankyrin 2 OS=Homo sapiens OX=9606 GN=ANK2 PE=1 SV=1
18	A0A5F9ZHL3	3.75e-41	167	1858	0.123	0.069	A0A5F9ZHL3_HUMAN Ankyrin 2 OS=Homo sapiens OX=9606 GN=ANK2 PE=1 SV=1
19	A0A5F9ZH03	3.88e-41	167	1785	0.123	0.072	A0A5F9ZH03_HUMAN Ankyrin 2 OS=Homo sapiens OX=9606 GN=ANK2 PE=1 SV=1
20	F1M5N3	2.73e-40	165	3966	0.126	0.033	F1M5N3_RAT Ankyrin 2 OS=Rattus norvegicus OX=10116 GN=Ank2 PE=1 SV=4

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00023 Ank	3.8e-48	171.2	Ankyrin repeat
2	PF12796 Ank_2	7.5e-62	217.2	Ankyrin repeats (3 copies)
3	PF13606 Ank_3	2.3e-36	130.5	Ankyrin repeat
4	PF13637 Ank_4	7.8e-44	158.8	Ankyrin repeats (many copies)
5	PF13857 Ank_5	1e-39	145.3	Ankyrin repeats (many copies)
6	PF08308 PEGA	2e+02	13.3	PEGA domain
7	PF00268 Ribonuc_red_sm	3.6e+02	12.0	Ribonucleotide reductase, small chain
8	PF02204 VPS9	4.5e-21	86.4	Vacuolar sorting protein 9 (VPS9) domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000304292

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000356465	0.985	Ras-related protein Rab-32
2	9606.ENSP00000261263	0.981	Ras-related protein Rab-21
3	9606.ENSP00000262640	0.980	Vesicle-associated membrane protein 7
4	9606.ENSP00000243662	0.940	Ras-related protein Rab-38
5	9606.ENSP00000480853	0.940	Vacuolar protein sorting-associated protein 29
6	9606.ENSP00000369538	0.927	Rab GDP dissociation inhibitor beta
7	9606.ENSP00000394071	0.924	Rab GDP dissociation inhibitor alpha
8	9606.ENSP00000355511	0.906	Rab proteins geranylgeranyltransferase component A 2
9	9606.ENSP00000350386	0.905	Rab proteins geranylgeranyltransferase component A 1
10	9606.ENSP00000385247	0.807	Calpain-14
11	9606.ENSP00000363339	0.754	UBX domain-containing protein 11
12	9606.ENSP00000287748	0.746	Lysozyme-like protein 4
13	9606.ENSP00000290208	0.742	Mitochondrial ribosomal protein L10
14	9606.ENSP00000445408	0.737	Rab GTPase-binding effector protein 1
15	9606.ENSP00000483897	0.734	Lysozyme-like protein 6
16	9606.ENSP00000349305	0.683	Golgin subfamily A member 4
17	9606.ENSP00000299138	0.674	Vacuolar protein sorting-associated protein 35
18	9606.ENSP00000373570	0.665	5,6-dihydroxyindole-2-carboxylic acid oxidase
19	9606.ENSP00000451752	0.638	Spectrin beta chain, erythrocytic
20	9606.ENSP00000301046	0.636	Alpha-lactalbumin

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0000149	0.998	SNARE binding
GO:0031267	0.978	small GTPase binding
GO:0030695	0.975	GTPase regulator activity
GO:0140678	0.961	molecular function inhibitor activity
GO:0140677	0.959	molecular function activator activity
GO:0005085	0.721	guanyl-nucleotide exchange factor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.996	regulation of biological process
GO:0050794	0.993	regulation of cellular process
GO:0009987	0.969	cellular process
GO:0048518	0.960	positive regulation of biological process
GO:0048522	0.934	positive regulation of cellular process
GO:0051179	0.827	localization
GO:0006810	0.783	transport
GO:0051128	0.750	regulation of cellular component organization
GO:0120035	0.690	regulation of plasma membrane bounded cell projection organization
GO:0031346	0.588	positive regulation of cell projection organization
GO:0016192	0.568	vesicle-mediated transport
GO:0051641	0.566	cellular localization
GO:0046907	0.461	intracellular transport
GO:0051668	0.429	localization within membrane
GO:0010975	0.377	regulation of neuron projection development
GO:0016043	0.328	cellular component organization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0043231	1.000	intracellular membrane-bounded organelle
GO:0012505	0.999	endomembrane system
GO:0016020	0.996	membrane
GO:0031982	0.996	vesicle
GO:0031410	0.994	cytoplasmic vesicle
GO:0005886	0.993	plasma membrane
GO:0005829	0.992	cytosol
GO:0005768	0.949	endosome
GO:0005764	0.907	lysosome
GO:0005769	0.885	early endosome
GO:0031090	0.827	organelle membrane
GO:0005770	0.458	late endosome
GO:0097422	0.389	tubular endosome
GO:0098588	0.380	bounding membrane of organelle
GO:0042995	0.370	cell projection
GO:0120025	0.321	plasma membrane bounded cell projection

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]