StarFunc result for job id Q96NW7

User Input

>input (1537 residues)
MTTKRKIIGRLVPCRCFRGEEEIISVLDYSHCSLQQVPKEVFNFERTLEELYLDANQIEE
LPKQLFNCQALRKLSIPDNDLSNLPTTIASLVNLKELDISKNGVQEFPENIKCCKCLTII
EASVNPISKLPDGFTQLLNLTQLYLNDAFLEFLPANFGRLVKLRILELRENHLKTLPKSM
HKLAQLERLDLGNNEFGELPEVLDQIQNLRELWMDNNALQVLPGSIGKLKMLVYLDMSKN
RIETVDMDISGCEALEDLLLSSNMLQQLPDSIGLLKKLTTLKVDDNQLTMLPNTIGNLSL
LEEFDCSCNELESLPSTIGYLHSLRTLAVDENFLPELPREIGSCKNVTVMSLRSNKLEFL
PEEIGQMQKLRVLNLSDNRLKNLPFSFTKLKELAALWLSDNQSKALIPLQTEAHPETKQR
VLTNYMFPQQPRGDEDFQSDSDSFNPTLWEEQRQQRMTVAFEFEDKKEDDENAGKVKDLS
CQAPWERGQRGITLQPARLSGDCCTPWARCDQQIQDMPVPQNDPQLAWGCISGLQQERSM
CTPLPVAAQSTTLPSLSGRQVEINLKRYPTPYPEDLKNMVKSVQNLVGKPSHGVRVENSN
PTANTEQTVKEKYEHKWPVAPKEITVEDSFVHPANEMRIGELHPSLAETPLYPPKLVLLG
KDKKESTDESEVDKTHCLNNSVSSGTYSDYSPSQASSGSSNTRVKVGSLQTTAKDAVHNS
LWGNRIAPSFPQPLDSKPLLSQREAVPPGNIPQRPDRLPMSDTFTDNWTDGSHYDNTGFV
AEETTAENANSNPLLSSKSRSTSSHGRRPLIRQDRIVGVPLELEQSTHRHTPETEVPPSN
PWQNWTRTPSPFEDRTAFPSKLETTPTTSPLPERKEHIKESTEIPSPFSPGVPWEYHDSN
PNRSLSNVFSQIHCRPESSKGVISISKSTERLSPLMKDIKSNKFKKSQSIDEIDIGTYKV
YNIPLENYASGSDHLGSHERPDKMLGPEHGMSSMSRSQSVPMLDDEMLTYGSSKGPQQQK
ASMTKKVYQFDQSFNPQGSVEVKAEKRIPPPFQHNPEYVQQASKNIAKDLISPRAYRGYP
PMEQMFSFSQPSVNEDAVVNAQFASQGARAGFLRRADSLVSATEMAMFRRVNEPHELPPT
DRYGRPPYRGGLDRQSSVTVTESQFLKRNGRYEDEHPSYQEVKAQAGSFPVKNLTQRRPL
SARSYSTESYGASQTRPVSARPTMAALLEKIPSDYNLGNYGDKPSDNSDLKTRPTPVKGE
ESCGKMPADWRQQLLRHIEARRLDRNAAYKHNTVNLGMLPYGGISAMHAGRSMTLNLQTK
SKFDHQELPLQKTPSQQSNILDNGQEDVSPSGQWNPYPLGRRDVPPDTITKKAGSHIQTL
MGSQSLQHRSREQQPYEGNINKVTIQQFQSPLPIQIPSSQATRGPQPGRCLIQTKGQRSM
DGYPEQFCVRIEKNPGLGFSISGGISGQGNPFKPSDKGIFVTRVQPDGPASNLLQPGDKI
LQANGHSFVHMEHEKAVLLLKSFQNTVDLVIQRELTV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P70587	0.369	0.379	0.000	1490	0.924	0.953	P70587.pdb.gz	LRRC7_RAT Leucine-rich repeat-containing protein 7 OS=Rattus norvegicus OX=10116 GN=Lrrc7 PE=1 SV=2
2	AFDB:Q96NW7	1.000	1.000	0.000	1537	1.000	1.000	Q96NW7.pdb.gz	LRRC7_HUMAN Leucine-rich repeat-containing protein 7 OS=Homo sapiens OX=9606 GN=LRRC7 PE=1 SV=1
3	AFDB:Q80TH2	0.311	0.339	1.793E-87	1402	0.388	0.426	Q80TH2.pdb.gz	ERBIN_MOUSE Erbin OS=Mus musculus OX=10090 GN=Erbin PE=1 SV=3
4	AFDB:Q96RT1	0.326	0.353	3.793E-86	1412	0.385	0.419	Q96RT1.pdb.gz	ERBIN_HUMAN Erbin OS=Homo sapiens OX=9606 GN=ERBIN PE=1 SV=2
5	AFDB:M0R9T2	0.180	0.214	3.324E-51	1258	0.284	0.347	M0R9T2.pdb.gz	M0R9T2_RAT Erbb2 interacting protein OS=Rattus norvegicus OX=10116 GN=Erbin PE=1 SV=3
6	AFDB:D3ZWS0	0.269	0.249	1.167E-48	1663	0.240	0.222	D3ZWS0.pdb.gz	D3ZWS0_RAT Scribble planar cell polarity protein OS=Rattus norvegicus OX=10116 GN=Scrib PE=1 SV=2
7	AFDB:Q14160	0.274	0.259	1.417E-48	1630	0.243	0.229	Q14160.pdb.gz	SCRIB_HUMAN Protein scribble homolog OS=Homo sapiens OX=9606 GN=SCRIB PE=1 SV=5
8	AFDB:Q7KRY7	0.273	0.228	4.113E-48	1851	0.220	0.183	Q7KRY7.pdb.gz	SCRIB_DROME Protein lap4 OS=Drosophila melanogaster OX=7227 GN=scrib PE=1 SV=1
9	AFDB:Q80U72	0.277	0.265	1.556E-46	1612	0.232	0.221	Q80U72.pdb.gz	SCRIB_MOUSE Protein scribble homolog OS=Mus musculus OX=10090 GN=Scrib PE=1 SV=2
10	AFDB:Q9BTT6	0.272	0.782	1.393E-38	524	0.133	0.391	Q9BTT6.pdb.gz	LRRC1_HUMAN Leucine-rich repeat-containing protein 1 OS=Homo sapiens OX=9606 GN=LRRC1 PE=1 SV=1
11	PDB:7tvfD	0.223	0.610	8.195E-24	515	0.078	0.233	7tvfD.pdb.gz	Structure of the SHOC2-MRAS-PP1C complex provides insights into RAF activation and Noonan syndrome.
12	PDB:7p5vB	0.178	0.351	1.749E-13	732	0.066	0.138	7p5vB.pdb.gz
13	PDB:7qqmA	0.062	0.228	7.289E-12	413	0.060	0.223	7qqmA.pdb.gz	A scalable strategy to solve structures of PDZ domains and their complexes.
14	PDB:6hkwA	0.163	0.732	1.507E-11	306	0.044	0.219	6hkwA.pdb.gz
15	PDB:6gffI	0.203	0.511	2.447E-11	551	0.074	0.207	6gffI.pdb.gz
16	PDB:7wv3A	0.156	0.281	6.766E-11	668	0.068	0.157	7wv3A.pdb.gz	TLR3 forms a highly organized cluster when bound to a poly(I:C) RNA ligand.
17	PDB:6m04A	0.175	0.344	1.542E-10	714	0.057	0.123	6m04A.pdb.gz
18	PDB:7lt9A	0.120	0.681	2.109E-9	251	0.038	0.235	7lt9A.pdb.gz	Molecular basis for Ras suppressor-1 binding to PINCH-1 in focal adhesion assembly.
19	PDB:5xjxC	0.158	0.595	2.960E-9	365	0.050	0.211	5xjxC.pdb.gz
20	PDB:1xcdA	0.141	0.570	3.592E-9	305	0.048	0.243	1xcdA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A075B6E9	0.0	3048	1495	0.966	0.993	A0A075B6E9_HUMAN Leucine rich repeat containing 7 OS=Homo sapiens OX=9606 GN=LRRC7 PE=1 SV=1
2	A0A494C1A4	0.0	3180	1575	1.000	0.976	A0A494C1A4_HUMAN Leucine rich repeat containing 7 OS=Homo sapiens OX=9606 GN=LRRC7 PE=1 SV=1
3	A0A8I5ZN42	0.0	701	1230	0.217	0.272	A0A8I5ZN42_RAT Erbb2 interacting protein OS=Rattus norvegicus OX=10116 GN=Erbin PE=1 SV=1
4	A0A8I5ZWX2	0.0	699	1403	0.217	0.238	A0A8I5ZWX2_RAT Erbb2 interacting protein OS=Rattus norvegicus OX=10116 GN=Erbin PE=1 SV=1
5	A0A8I6A8N1	0.0	700	1295	0.217	0.258	A0A8I6A8N1_RAT Erbb2 interacting protein OS=Rattus norvegicus OX=10116 GN=Erbin PE=1 SV=1
6	A0A8I6ACI5	0.0	700	1364	0.217	0.245	A0A8I6ACI5_RAT Erbb2 interacting protein OS=Rattus norvegicus OX=10116 GN=Erbin PE=1 SV=1
7	A0A8I6AE43	0.0	701	1451	0.217	0.230	A0A8I6AE43_RAT Erbb2 interacting protein OS=Rattus norvegicus OX=10116 GN=Erbin PE=1 SV=1
8	A1L1C6	0.0	1683	821	0.528	0.989	A1L1C6_HUMAN LRRC7 protein OS=Homo sapiens OX=9606 GN=LRRC7 PE=1 SV=1
9	P70587	0.0	2904	1490	0.921	0.950	LRRC7_RAT Leucine-rich repeat-containing protein 7 OS=Rattus norvegicus OX=10116 GN=Lrrc7 PE=1 SV=2
10	Q80TH2	0.0	697	1402	0.217	0.238	ERBIN_MOUSE Erbin OS=Mus musculus OX=10090 GN=Erbin PE=1 SV=3
11	Q96NW7	0.0	3181	1537	1.000	1.000	LRRC7_HUMAN Leucine-rich repeat-containing protein 7 OS=Homo sapiens OX=9606 GN=LRRC7 PE=1 SV=1
12	Q96RT1	0.0	702	1412	0.219	0.239	ERBIN_HUMAN Erbin OS=Homo sapiens OX=9606 GN=ERBIN PE=1 SV=2
13	Q9BTT6	5.51e-110	361	524	0.129	0.380	LRRC1_HUMAN Leucine-rich repeat-containing protein 1 OS=Homo sapiens OX=9606 GN=LRRC1 PE=1 SV=1
14	Q7KRY7	2.84e-109	386	1851	0.140	0.116	SCRIB_DROME Protein lap4 OS=Drosophila melanogaster OX=7227 GN=scrib PE=1 SV=1
15	Q14160	3.04e-107	379	1630	0.135	0.127	SCRIB_HUMAN Protein scribble homolog OS=Homo sapiens OX=9606 GN=SCRIB PE=1 SV=5
16	A0A669KB89	3.93e-107	378	1658	0.135	0.125	A0A669KB89_HUMAN Scribble planar cell polarity protein OS=Homo sapiens OX=9606 GN=SCRIB PE=1 SV=1
17	Q4H4B6	5.49e-107	379	1724	0.140	0.125	SCRIB_DANRE Protein scribble homolog OS=Danio rerio OX=7955 GN=scrib PE=1 SV=1
18	Q80U72	6.63e-107	377	1612	0.131	0.125	SCRIB_MOUSE Protein scribble homolog OS=Mus musculus OX=10090 GN=Scrib PE=1 SV=2
19	A0A8I6ANK4	6.71e-107	377	1589	0.131	0.127	A0A8I6ANK4_RAT Scribble planar cell polarity protein OS=Rattus norvegicus OX=10116 GN=Scrib PE=1 SV=1
20	A0A8I6APB3	8.32e-107	377	1610	0.131	0.125	A0A8I6APB3_RAT Scribble planar cell polarity protein OS=Rattus norvegicus OX=10116 GN=Scrib PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12799 LRR_4	8e-23	91.3	Leucine Rich repeats (2 copies)
2	PF13306 LRR_5	0.56	21.6	BspA type Leucine rich repeat region (6 copies)
3	PF13855 LRR_8	4.5e-33	124.1	Leucine rich repeat
4	PF00595 PDZ	4.5e-13	60.7	PDZ domain
5	PF13180 PDZ_2	0.034	25.8	PDZ domain
6	PF17820 PDZ_6	0.0043	28.2	PDZ domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000035383

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000362680	0.942	Proto-oncogene tyrosine-protein kinase Src
2	9606.ENSP00000428994	0.941	Glutamate receptor 1
3	9606.ENSP00000296526	0.931	Glutamate receptor 2
4	9606.ENSP00000407586	0.931	GTPase HRas
5	9606.ENSP00000256078	0.930	GTPase KRas
6	9606.ENSP00000358548	0.930	GTPase NRas
7	9606.ENSP00000481554	0.924	Glutamate receptor 3
8	9606.ENSP00000282499	0.916	Glutamate receptor 4
9	9606.ENSP00000381412	0.879	Calcium/calmodulin-dependent protein kinase type II subunit alpha
10	9606.ENSP00000477455	0.871	Glutamate receptor ionotropic, NMDA 2B
11	9606.ENSP00000307134	0.865	Catenin delta-2
12	9606.ENSP00000345719	0.830	Torsin-1A
13	9606.ENSP00000382428	0.827	Disks large homolog 4
14	9606.ENSP00000443495	0.802	Alpha-actinin-2
15	9606.ENSP00000365272	0.783	Disks large homolog 2
16	9606.ENSP00000379818	0.781	Glutamate receptor ionotropic, NMDA 2A
17	9606.ENSP00000345731	0.763	Disks large homolog 1
18	9606.ENSP00000363480	0.755	Disks large homolog 3
19	9606.ENSP00000293441	0.751	SH3 and multiple ankyrin repeat domains protein 1
20	9606.ENSP00000432172	0.751	Coiled-coil domain containing 17

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.998	regulation of biological process
GO:0050794	0.994	regulation of cellular process
GO:0050896	0.991	response to stimulus
GO:0051128	0.893	regulation of cellular component organization
GO:0009987	0.891	cellular process
GO:0048518	0.890	positive regulation of biological process
GO:0048522	0.883	positive regulation of cellular process
GO:0042221	0.798	response to chemical
GO:0051130	0.685	positive regulation of cellular component organization
GO:0010033	0.674	response to organic substance
GO:0031344	0.590	regulation of cell projection organization
GO:0051716	0.583	cellular response to stimulus
GO:0120035	0.563	regulation of plasma membrane bounded cell projection organization
GO:0031346	0.493	positive regulation of cell projection organization
GO:0010975	0.481	regulation of neuron projection development
GO:0007154	0.455	cell communication
GO:0023052	0.439	signaling
GO:0010976	0.409	positive regulation of neuron projection development
GO:0048583	0.384	regulation of response to stimulus
GO:0051179	0.366	localization
GO:0010646	0.359	regulation of cell communication
GO:0007165	0.333	signal transduction
GO:0023051	0.324	regulation of signaling
GO:0019222	0.305	regulation of metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.995	cytoplasm
GO:0043229	0.995	intracellular organelle
GO:0005829	0.993	cytosol
GO:0005886	0.990	plasma membrane
GO:0005654	0.990	nucleoplasm
GO:0043232	0.981	intracellular non-membrane-bounded organelle
GO:0005856	0.533	cytoskeleton
GO:0030054	0.446	cell junction
GO:0015630	0.413	microtubule cytoskeleton
GO:0035580	0.366	specific granule lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]