StarFunc result for job id Q96NZ8

User Input

>input (548 residues)
MPALRPLLPLLLLLRLTSGAGLLPGLGSHPGVCPNQLSPNLWVDAQSTCERECSRDQDCA
AAEKCCINVCGLHSCVAARFPGSPAAPTTAASCEGFVCPQQGSDCDIWDGQPVCRCRDRC
EKEPSFTCASDGLTYYNRCYMDAEACLRGLHLHIVPCKHVLSWPPSSPGPPETTARPTPG
AAPVPPALYSSPSPQAVQVGGTASLHCDVSGRPPPAVTWEKQSHQRENLIMRPDQMYGNV
VVTSIGQLVLYNARPEDAGLYTCTARNAAGLLRADFPLSVVQREPARDAAPSIPAPAECL
PDVQACTGPTSPHLVLWHYDPQRGGCMTFPARGCDGAARGFETYEACQQACARGPGDACV
LPAVQGPCRGWEPRWAYSPLLQQCHPFVYGGCEGNGNNFHSRESCEDACPVPRTPPCRAC
RLRSKLALSLCRSDFAIVGRLTEVLEEPEAAGGIARVALEDVLKDDKMGLKFLGTKYLEV
TLSGMDWACPCPNMTAGDGPLVIMGEVRDGVAVLDAGSYVRAASEKRVKKILELLEKQAC
ELLNRFQD

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q96NZ8	1.000	1.000	0.000	548	1.000	1.000	Q96NZ8.pdb.gz	WFKN1_HUMAN WAP, Kazal, immunoglobulin, Kunitz and NTR domain-containing protein 1 OS=Homo sapiens OX=9606 GN=WFIKKN1 PE=1 SV=1
2	AFDB:Q8R0S6	0.517	0.513	7.279E-99	552	0.878	0.871	Q8R0S6.pdb.gz	WFKN1_MOUSE WAP, Kazal, immunoglobulin, Kunitz and NTR domain-containing protein 1 OS=Mus musculus OX=10090 GN=Wfikkn1 PE=2 SV=2
3	AFDB:Q8TEU8	0.409	0.394	4.655E-71	576	0.557	0.530	Q8TEU8.pdb.gz	WFKN2_HUMAN WAP, Kazal, immunoglobulin, Kunitz and NTR domain-containing protein 2 OS=Homo sapiens OX=9606 GN=WFIKKN2 PE=1 SV=1
4	AFDB:Q5STE3	0.128	0.084	9.000E-11	841	0.182	0.119	Q5STE3.pdb.gz	FSTL4_MOUSE Follistatin-related protein 4 OS=Mus musculus OX=10090 GN=Fstl4 PE=2 SV=1
5	AFDB:A0A0G2JZA1	0.175	0.065	6.702E-10	1512	0.131	0.048	A0A0G2JZA1.pdb.gz	A0A0G2JZA1_RAT Roundabout guidance receptor 2 OS=Rattus norvegicus OX=10116 GN=Robo2 PE=4 SV=2
6	AFDB:G5EBF1	0.169	0.076	6.702E-10	1273	0.141	0.060	G5EBF1.pdb.gz	SAX3_CAEEL Protein sax-3 OS=Caenorhabditis elegans OX=6239 GN=sax-3 PE=2 SV=1
7	AFDB:A4JYH1	0.171	0.110	9.365E-10	862	0.120	0.077	A4JYH1.pdb.gz
8	AFDB:Q8N475	0.149	0.100	2.417E-9	847	0.186	0.120	Q8N475.pdb.gz	FSTL5_HUMAN Follistatin-related protein 5 OS=Homo sapiens OX=9606 GN=FSTL5 PE=2 SV=2
9	AFDB:F1QBD4	0.172	0.069	3.194E-9	1387	0.126	0.050	F1QBD4.pdb.gz
10	AFDB:Q96MS0	0.168	0.068	8.244E-9	1386	0.119	0.047	Q96MS0.pdb.gz	ROBO3_HUMAN Roundabout homolog 3 OS=Homo sapiens OX=9606 GN=ROBO3 PE=1 SV=2
11	PDB:6dlfA	0.151	0.341	1.250E-6	236	0.044	0.102	6dlfA.pdb.gz
12	PDB:4bd9B	0.103	0.317	1.747E-6	165	0.073	0.242	4bd9B.pdb.gz	A Noncanonical Mechanism of Carboxypeptidase Inhibition Revealed by the Crystal Structure of the Tri-Kunitz Smci in Complex with Human Cpa4.
13	PDB:6feyB	0.169	0.431	2.886E-6	207	0.057	0.150	6feyB.pdb.gz	Structures of insect Imp-L2 suggest an alternative strategy for regulating the bioavailability of insulin-like hormones.
14	PDB:5hhmI	0.152	0.389	4.264E-6	196	0.047	0.133	5hhmI.pdb.gz	Molecular basis for universal HLA-A*0201-restricted CD8+ T-cell immunity against influenza viruses.
15	PDB:1ueaB	0.163	0.447	5.635E-6	181	0.035	0.105	1ueaB.pdb.gz	Mechanism of inhibition of the human matrix metalloproteinase stromelysin-1 by TIMP-1.
16	PDB:6feyD	0.157	0.513	9.309E-6	160	0.044	0.150	6feyD.pdb.gz	Structures of insect Imp-L2 suggest an alternative strategy for regulating the bioavailability of insulin-like hormones.
17	PDB:3o3uN	0.160	0.152	1.301E-5	580	0.071	0.067	3o3uN.pdb.gz	The 1.5 A crystal structure of human receptor for advanced glycation endproducts (RAGE) ectodomains reveals unique features determining ligand binding.
18	PDB:1f6lL	0.157	0.702	1.454E-5	106	0.033	0.170	1f6lL.pdb.gz
19	PDB:5ir3A	0.154	0.660	1.818E-5	111	0.035	0.171	5ir3A.pdb.gz
20	PDB:6sm1A	0.153	0.656	2.149E-5	111	0.031	0.153	6sm1A.pdb.gz	Fatal amyloid formation in a patient's antibody light chain is caused by a single point mutation.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q7TQN3	0.0	598	571	0.553	0.531	WFKN2_MOUSE WAP, Kazal, immunoglobulin, Kunitz and NTR domain-containing protein 2 OS=Mus musculus OX=10090 GN=Wfikkn2 PE=1 SV=2
2	Q8R0S6	0.0	955	552	0.878	0.871	WFKN1_MOUSE WAP, Kazal, immunoglobulin, Kunitz and NTR domain-containing protein 1 OS=Mus musculus OX=10090 GN=Wfikkn1 PE=2 SV=2
3	Q8TEU8	0.0	605	576	0.555	0.528	WFKN2_HUMAN WAP, Kazal, immunoglobulin, Kunitz and NTR domain-containing protein 2 OS=Homo sapiens OX=9606 GN=WFIKKN2 PE=1 SV=1
4	Q96NZ8	0.0	1112	548	1.000	1.000	WFKN1_HUMAN WAP, Kazal, immunoglobulin, Kunitz and NTR domain-containing protein 1 OS=Homo sapiens OX=9606 GN=WFIKKN1 PE=1 SV=1
5	P84875	1.56e-19	88.2	165	0.086	0.285	PCPI_SABMA Carboxypeptidase inhibitor SmCI OS=Sabellastarte magnifica OX=389514 PE=1 SV=1
6	P86733	3.42e-18	82.8	126	0.075	0.325	KCP_HALAI BPTI/Kunitz domain-containing protein (Fragment) OS=Haliotis asinina OX=109174 PE=1 SV=1
7	Q1WCN6	3.00e-17	83.2	233	0.075	0.176	Q1WCN6_DANRE Tissue factor pathway inhibitor OS=Danio rerio OX=7955 GN=si:ch211-262k23.2 PE=2 SV=1
8	O76840	1.17e-16	86.3	2167	0.095	0.024	PPN1_CAEEL Papilin OS=Caenorhabditis elegans OX=6239 GN=mig-6 PE=1 SV=1
9	Q64240	1.25e-16	83.6	349	0.071	0.112	AMBP_RAT Protein AMBP OS=Rattus norvegicus OX=10116 GN=Ambp PE=1 SV=1
10	Q868Z9	7.80e-16	84.0	2898	0.078	0.015	PPN_DROME Papilin OS=Drosophila melanogaster OX=7227 GN=Ppn PE=1 SV=2
11	Q07456	1.64e-15	80.5	349	0.071	0.112	AMBP_MOUSE Protein AMBP OS=Mus musculus OX=10090 GN=Ambp PE=1 SV=2
12	P02760	2.82e-15	79.7	352	0.078	0.122	AMBP_HUMAN Protein AMBP OS=Homo sapiens OX=9606 GN=AMBP PE=1 SV=1
13	O54819	2.09e-13	73.6	306	0.078	0.141	TFPI1_MOUSE Tissue factor pathway inhibitor OS=Mus musculus OX=10090 GN=Tfpi PE=2 SV=1
14	P48307	2.17e-13	72.0	235	0.075	0.174	TFPI2_HUMAN Tissue factor pathway inhibitor 2 OS=Homo sapiens OX=9606 GN=TFPI2 PE=1 SV=1
15	Q02445	4.18e-13	72.4	302	0.071	0.129	TFPI1_RAT Tissue factor pathway inhibitor OS=Rattus norvegicus OX=10116 GN=Tfpi PE=2 SV=1
16	G3V8S0	1.15e-12	70.5	258	0.071	0.151	G3V8S0_RAT Serine peptidase inhibitor, Kunitz type, 2 OS=Rattus norvegicus OX=10116 GN=Spint2 PE=1 SV=2
17	P10646	1.27e-12	70.9	304	0.069	0.125	TFPI1_HUMAN Tissue factor pathway inhibitor OS=Homo sapiens OX=9606 GN=TFPI PE=1 SV=1
18	Q90WA1	4.69e-12	63.9	83	0.051	0.337	VKT1_PSETT Kunitz-type serine protease inhibitor textilinin-1 OS=Pseudonaja textilis textilis OX=169397 PE=1 SV=1
19	D8KY58	5.28e-12	63.9	82	0.046	0.305	VKT_BOMTE Kunitz-type serine protease inhibitor Bt-KTI OS=Bombus terrestris OX=30195 PE=2 SV=1
20	Q5ZR36	6.02e-12	71.2	1818	0.068	0.020	Q5ZR36_CAEEL Kunitz/Bovine pancreatic trypsin inhibitor domain protein OS=Caenorhabditis elegans OX=6239 GN=mec-1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07679 I-set	8.5e-12	56.3	Immunoglobulin I-set domain
2	PF00047 ig	1.6e-06	39.5	Immunoglobulin domain
3	PF13895 Ig_2	8.5e-08	43.7	Immunoglobulin domain
4	PF13927 Ig_3	1.4e-12	59.2	Immunoglobulin domain
5	PF07648 Kazal_2	6	18.4	Kazal-type serine protease inhibitor domain
6	PF00014 Kunitz_BPTI	2e-21	87.2	Kunitz/Bovine pancreatic trypsin inhibitor domain
7	PF07686 V-set	0.0016	29.9	Immunoglobulin V-set domain
8	PF00095 WAP	1.7e-06	39.6	WAP-type (Whey Acidic Protein) 'four-disulfide core'

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000324763

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000260950	0.844	Growth/differentiation factor 8
2	9606.ENSP00000257868	0.815	Growth/differentiation factor 11
3	9606.ENSP00000359532	0.770	Neurotensin receptor type 1
4	9606.ENSP00000256759	0.742	Follistatin
5	9606.ENSP00000327608	0.733	ADAMTS-like protein 5
6	9606.ENSP00000245451	0.706	Bone morphogenetic protein 4
7	9606.ENSP00000166139	0.682	Follistatin-related protein 3
8	9606.ENSP00000252809	0.659	Growth differentiation factor 15
9	9606.ENSP00000279058	0.652	Serine peptidase inhibitor, Kunitz type 4
10	9606.ENSP00000384950	0.648	Sulfotransferase 6B1
11	9606.ENSP00000342082	0.606	Antileukoproteinase
12	9606.ENSP00000362759	0.570	Adhesion G protein-coupled receptor B2
13	9606.ENSP00000368104	0.564	Bone morphogenetic protein 2
14	9606.ENSP00000343200	0.509	SKI family transcriptional corepressor 1
15	9606.ENSP00000284273	0.507	Ubiquitin-associated and SH3 domain-containing protein B

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0098772	0.995	molecular function regulator activity
GO:0030545	0.983	signaling receptor regulator activity
GO:0140678	0.977	molecular function inhibitor activity
GO:0019838	0.975	growth factor binding
GO:0050431	0.970	transforming growth factor beta binding
GO:0030547	0.965	signaling receptor inhibitor activity
GO:0005102	0.947	signaling receptor binding
GO:0048019	0.571	receptor antagonist activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0065007	0.990	biological regulation
GO:0050794	0.976	regulation of cellular process
GO:0009987	0.937	cellular process
GO:0090092	0.851	regulation of transmembrane receptor protein serine/threonine kinase signaling pathway
GO:0090101	0.783	negative regulation of transmembrane receptor protein serine/threonine kinase signaling pathway
GO:0090287	0.719	regulation of cellular response to growth factor stimulus
GO:0017015	0.652	regulation of transforming growth factor beta receptor signaling pathway
GO:0032501	0.649	multicellular organismal process
GO:0030512	0.616	negative regulation of transforming growth factor beta receptor signaling pathway
GO:0032502	0.605	developmental process
GO:0048856	0.602	anatomical structure development
GO:0050896	0.539	response to stimulus
GO:0007275	0.414	multicellular organism development
GO:0048731	0.360	system development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005576	1.000	extracellular region
GO:0005615	0.881	extracellular space
GO:0043226	0.799	organelle
GO:0043227	0.684	membrane-bounded organelle
GO:0005622	0.390	intracellular anatomical structure
GO:0043231	0.322	intracellular membrane-bounded organelle
GO:0005737	0.307	cytoplasm
GO:0071944	0.300	cell periphery

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]