StarFunc result for job id Q96NZ9

User Input

>input (151 residues)
MRRLLLVTSLVVVLLWEAGAVPAPKVPIKMQVKHWPSEQDPEKAWGARVVEPPEKDDQLV
VLFPVQKPKLLTTEEKPRGQGRGPILPGTKAWMETEDTLGHVLSPEPDHDSLYHPPPEED
QGEERPRLWVMPNHQVLLGPEEDQDHIYHPQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q96NZ9	1.000	1.000	1.450E-21	151	1.000	1.000	Q96NZ9.pdb.gz	PRAP1_HUMAN Proline-rich acidic protein 1 OS=Homo sapiens OX=9606 GN=PRAP1 PE=1 SV=2
2	AFDB:Q80XD8	0.266	0.267	4.290E-8	149	0.477	0.483	Q80XD8.pdb.gz	PRAP1_MOUSE Proline-rich acidic protein 1 OS=Mus musculus OX=10090 GN=Prap1 PE=1 SV=1
3	AFDB:Q8IV31	0.141	0.105	2.319	216	0.192	0.134	Q8IV31.pdb.gz	TM139_HUMAN Transmembrane protein 139 OS=Homo sapiens OX=9606 GN=TMEM139 PE=1 SV=1
4	AFDB:Q01197	0.158	0.108	5.045	238	0.099	0.063	Q01197.pdb.gz	E6_GOSHI Protein E6 OS=Gossypium hirsutum OX=3635 GN=E6 PE=2 SV=1
5	AFDB:Q9UM82	0.112	0.041	6.693	520	0.245	0.071	Q9UM82.pdb.gz	SPAT2_HUMAN Spermatogenesis-associated protein 2 OS=Homo sapiens OX=9606 GN=SPATA2 PE=1 SV=2
6	AFDB:Q13634	0.156	0.043	7.183	790	0.106	0.020	Q13634.pdb.gz	CAD18_HUMAN Cadherin-18 OS=Homo sapiens OX=9606 GN=CDH18 PE=2 SV=1
7	AFDB:Q54S82	0.120	0.068	7.183	326	0.179	0.083	Q54S82.pdb.gz	Q54S82_DICDI Proteasome inhibitor PI31 subunit OS=Dictyostelium discoideum OX=44689 GN=psmF1 PE=3 SV=1
8	AFDB:Q96NL3	0.149	0.049	7.183	588	0.172	0.044	Q96NL3.pdb.gz	ZN599_HUMAN Zinc finger protein 599 OS=Homo sapiens OX=9606 GN=ZNF599 PE=1 SV=1
9	AFDB:P20438	0.140	0.044	8.274	545	0.139	0.039	P20438.pdb.gz	CG12_YEAST G1/S-specific cyclin CLN2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CLN2 PE=1 SV=2

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q96NZ9	3.46e-105	298	151	1.000	1.000	PRAP1_HUMAN Proline-rich acidic protein 1 OS=Homo sapiens OX=9606 GN=PRAP1 PE=1 SV=2
2	Q80XD8	8.97e-32	112	149	0.477	0.483	PRAP1_MOUSE Proline-rich acidic protein 1 OS=Mus musculus OX=10090 GN=Prap1 PE=1 SV=1
3	O00763	0.50	32.7	2458	0.146	0.009	ACACB_HUMAN Acetyl-CoA carboxylase 2 OS=Homo sapiens OX=9606 GN=ACACB PE=1 SV=3
4	O35161	3.1	30.4	3034	0.192	0.010	CELR1_MOUSE Cadherin EGF LAG seven-pass G-type receptor 1 OS=Mus musculus OX=10090 GN=Celsr1 PE=1 SV=3
5	P72989	4.4	29.3	181	0.073	0.061	P72989_SYNY3 Sll1507 protein OS=Synechocystis sp. (strain PCC 6803 / Kazusa) OX=1111708 GN=sll1507 PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF15314 PRAP	1.8e-20	84.2	Proline-rich acidic protein 1, pregnancy-specific uterine

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000416126

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000355251	0.821	Zinc finger protein 511
2	9606.ENSP00000258317	0.717	N-acetylneuraminate lyase
3	9606.ENSP00000484431	0.660	CD48 antigen
4	9606.ENSP00000369391	0.618	Ribonuclease P protein subunit p40
5	9606.ENSP00000278025	0.612	Fucose mutarotase
6	9606.ENSP00000353496	0.604	Leucine zipper putative tumor suppressor 3
7	9606.ENSP00000429216	0.596	TMF-regulated nuclear protein 1
8	9606.ENSP00000418082	0.595	Ribosomal protein L37a
9	9606.ENSP00000317872	0.587	E3 ubiquitin-protein ligase RBBP6
10	9606.ENSP00000355210	0.584	Transmembrane protein 184B
11	9606.ENSP00000309790	0.572	Mis18-binding protein 1
12	9606.ENSP00000351190	0.539	Inter-alpha-trypsin inhibitor heavy chain H2
13	9606.ENSP00000229329	0.518	N-acylneuraminate cytidylyltransferase
14	9606.ENSP00000484146	0.504	Semaphorin-3B

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.992	cellular process
GO:0050789	0.991	regulation of biological process
GO:0050896	0.979	response to stimulus
GO:0006950	0.956	response to stress
GO:0050794	0.949	regulation of cellular process
GO:0051716	0.936	cellular response to stimulus
GO:0048583	0.898	regulation of response to stimulus
GO:0006974	0.893	cellular response to DNA damage stimulus
GO:0051783	0.873	regulation of nuclear division
GO:1905818	0.871	regulation of chromosome separation
GO:0033045	0.871	regulation of sister chromatid segregation
GO:0072331	0.871	signal transduction by p53 class mediator
GO:1901991	0.871	negative regulation of mitotic cell cycle phase transition
GO:0044773	0.871	mitotic DNA damage checkpoint signaling
GO:0048518	0.870	positive regulation of biological process
GO:0048522	0.851	positive regulation of cellular process
GO:0051130	0.840	positive regulation of cellular component organization
GO:0010965	0.833	regulation of mitotic sister chromatid separation
GO:2000045	0.833	regulation of G1/S transition of mitotic cell cycle
GO:0033047	0.833	regulation of mitotic sister chromatid segregation
GO:1902099	0.833	regulation of metaphase/anaphase transition of cell cycle
GO:0030330	0.833	DNA damage response, signal transduction by p53 class mediator
GO:0090068	0.832	positive regulation of cell cycle process
GO:0007088	0.824	regulation of mitotic nuclear division
GO:1901989	0.824	positive regulation of cell cycle phase transition
GO:0030071	0.824	regulation of mitotic metaphase/anaphase transition
GO:2000134	0.824	negative regulation of G1/S transition of mitotic cell cycle
GO:0023051	0.822	regulation of signaling
GO:0010646	0.822	regulation of cell communication
GO:0010638	0.818	positive regulation of organelle organization
GO:1905820	0.801	positive regulation of chromosome separation
GO:0044819	0.801	mitotic G1/S transition checkpoint signaling
GO:0051984	0.779	positive regulation of chromosome segregation
GO:0051785	0.779	positive regulation of nuclear division
GO:1901976	0.779	regulation of cell cycle checkpoint
GO:0045931	0.740	positive regulation of mitotic cell cycle
GO:0008152	0.592	metabolic process
GO:0045840	0.590	positive regulation of mitotic nuclear division
GO:0010941	0.558	regulation of cell death
GO:0071704	0.552	organic substance metabolic process
GO:1901992	0.440	positive regulation of mitotic cell cycle phase transition
GO:0044237	0.397	cellular metabolic process
GO:0043067	0.365	regulation of programmed cell death
GO:0060548	0.362	negative regulation of cell death
GO:2001252	0.350	positive regulation of chromosome organization
GO:0043066	0.304	negative regulation of apoptotic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005576	1.000	extracellular region
GO:0005737	1.000	cytoplasm
GO:0043231	1.000	intracellular membrane-bounded organelle
GO:0012505	0.999	endomembrane system
GO:0005783	0.991	endoplasmic reticulum
GO:0005615	0.818	extracellular space
GO:0070013	0.339	intracellular organelle lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]