StarFunc result for job id Q96P09

User Input

>input (236 residues)
MTGYEARLITFGTWMYSVNKEQLARAGFYAIGQEDKVQCFHCGGGLANWKPKEDPWEQHA
KWYPGCKYLLEEKGHEYINNIHLTRSLEGALVQTTKKTPSLTKRISDTIFPNPMLQEAIR
MGFDFKDVKKIMEERIQTSGSNYKTLEVLVADLVSAQKDTTENELNQTSLQREISPEEPL
RRLQEEKLCKICMDRHIAVVFIPCGHLVTCKQCAEAVDRCPMCSAVIDFKQRVFMS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q6PIA0	0.690	0.690	5.885E-43	236	0.992	0.992	Q6PIA0.pdb.gz	Q6PIA0_HUMAN Baculoviral IAP repeat-containing 8 OS=Homo sapiens OX=9606 GN=BIRC8 PE=1 SV=1
2	AFDB:P98170	0.399	0.214	5.537E-36	497	0.797	0.378	P98170.pdb.gz	XIAP_HUMAN E3 ubiquitin-protein ligase XIAP OS=Homo sapiens OX=9606 GN=XIAP PE=1 SV=2
3	AFDB:Q60989	0.455	0.272	5.342E-35	496	0.780	0.371	Q60989.pdb.gz	XIAP_MOUSE E3 ubiquitin-protein ligase XIAP OS=Mus musculus OX=10090 GN=Xiap PE=1 SV=2
4	AFDB:A5D8Q0	0.364	0.189	1.605E-26	488	0.453	0.219	A5D8Q0.pdb.gz	XIAP_XENLA E3 ubiquitin-protein ligase XIAP OS=Xenopus laevis OX=8355 GN=xiap PE=2 SV=2
5	AFDB:H0YZU0	0.392	0.198	3.208E-26	485	0.483	0.235	H0YZU0.pdb.gz	H0YZU0_TAEGU X-linked inhibitor of apoptosis OS=Taeniopygia guttata OX=59729 GN=XIAP PE=3 SV=2
6	AFDB:Q8JHV9	0.351	0.212	3.810E-22	401	0.403	0.237	Q8JHV9.pdb.gz	BIR7A_XENLA Baculoviral IAP repeat-containing protein 7-A OS=Xenopus laevis OX=8355 GN=birc7-a PE=1 SV=1
7	AFDB:F7FLN8	0.350	0.133	2.937E-20	638	0.394	0.146	F7FLN8.pdb.gz	F7FLN8_RAT Baculoviral IAP repeat-containing 3 OS=Rattus norvegicus OX=10116 GN=Birc3 PE=3 SV=3
8	AFDB:O08863	0.355	0.143	1.608E-19	600	0.394	0.155	O08863.pdb.gz	BIRC3_MOUSE Baculoviral IAP repeat-containing protein 3 OS=Mus musculus OX=10090 GN=Birc3 PE=1 SV=2
9	AFDB:Q90660	0.346	0.138	3.645E-19	611	0.407	0.157	Q90660.pdb.gz	BIR_CHICK Inhibitor of apoptosis protein OS=Gallus gallus OX=9031 GN=ITA PE=2 SV=1
10	AFDB:A0A669KBC7	0.356	0.133	4.135E-19	645	0.424	0.155	A0A669KBC7.pdb.gz	A0A669KBC7_HUMAN Baculoviral IAP repeat containing 3 OS=Homo sapiens OX=9606 GN=BIRC3 PE=1 SV=1
11	PDB:6b5bA	0.330	0.067	4.445E-6	1199	0.144	0.028	6b5bA.pdb.gz
12	PDB:5yudA	0.332	0.065	7.356E-6	1238	0.148	0.028	5yudA.pdb.gz	Structural basis for specific flagellin recognition by the NLR protein NAIP5.
13	PDB:1m4mA	0.275	0.557	4.027E-5	112	0.123	0.259	1m4mA.pdb.gz	CRYSTAL STRUCTURE AND MUTAGENIC ANALYSIS OF THE INHIBITOR-OF-APOPTOSIS PROTEIN SURVIVIN
14	PDB:3uedC	0.263	0.437	8.574E-5	139	0.119	0.201	3uedC.pdb.gz	Molecular basis for phosphospecific recognition of histone H3 tails by Survivin paralogues at inner centromeres.
15	PDB:1b71A	0.120	0.140	4.217E-1	191	0.102	0.126	1b71A.pdb.gz	Alternative metal-binding sites in rubrerythrin.
16	PDB:3ihpB	0.177	0.069	1.155	681	0.097	0.034	3ihpB.pdb.gz	Covalent Ubiquitin-Usp5 Complex
17	PDB:4xgsB	0.119	0.158	1.582	164	0.072	0.104	4xgsB.pdb.gz	Structural Basis of Novel Iron-Uptake Route and Reaction Intermediates in Ferritins from Gram-Negative Bacteria
18	PDB:4r8pL	0.199	0.187	2.168	254	0.068	0.063	4r8pL.pdb.gz	Crystal structure of the PRC1 ubiquitylation module bound to the nucleosome.
19	PDB:5im3A	0.143	0.050	2.619	874	0.055	0.015	5im3A.pdb.gz	Structural Mechanism of Allosteric Activity Regulation in a Ribonucleotide Reductase with Double ATP Cones.
20	PDB:2ztdA	0.172	0.203	2.789	189	0.038	0.048	2ztdA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q6PIA0	1.30e-179	493	236	0.992	0.992	Q6PIA0_HUMAN Baculoviral IAP repeat-containing 8 OS=Homo sapiens OX=9606 GN=BIRC8 PE=1 SV=1
2	P98170	2.13e-144	414	497	0.801	0.380	XIAP_HUMAN E3 ubiquitin-protein ligase XIAP OS=Homo sapiens OX=9606 GN=XIAP PE=1 SV=2
3	Q9R0I6	1.03e-140	405	496	0.767	0.365	XIAP_RAT E3 ubiquitin-protein ligase XIAP OS=Rattus norvegicus OX=10116 GN=Xiap PE=2 SV=1
4	Q60989	1.98e-140	404	496	0.784	0.373	XIAP_MOUSE E3 ubiquitin-protein ligase XIAP OS=Mus musculus OX=10090 GN=Xiap PE=1 SV=2
5	A5D8Q0	5.60e-79	247	488	0.475	0.230	XIAP_XENLA E3 ubiquitin-protein ligase XIAP OS=Xenopus laevis OX=8355 GN=xiap PE=2 SV=2
6	H0YZU0	3.56e-77	242	485	0.483	0.235	H0YZU0_TAEGU X-linked inhibitor of apoptosis OS=Taeniopygia guttata OX=59729 GN=XIAP PE=3 SV=2
7	Q8JHV9	3.23e-54	181	401	0.403	0.237	BIR7A_XENLA Baculoviral IAP repeat-containing protein 7-A OS=Xenopus laevis OX=8355 GN=birc7-a PE=1 SV=1
8	Q24307	6.20e-41	148	498	0.377	0.179	DIAP2_DROME Death-associated inhibitor of apoptosis 2 OS=Drosophila melanogaster OX=7227 GN=Diap2 PE=1 SV=3
9	Q96CA5	5.70e-40	141	298	0.352	0.279	BIRC7_HUMAN Baculoviral IAP repeat-containing protein 7 OS=Homo sapiens OX=9606 GN=BIRC7 PE=1 SV=2
10	A2AWP0	1.30e-37	134	285	0.318	0.263	BIRC7_MOUSE Baculoviral IAP repeat-containing protein 7 OS=Mus musculus OX=10090 GN=Birc7 PE=2 SV=1
11	Q24306	7.65e-32	122	438	0.322	0.174	DIAP1_DROME Death-associated inhibitor of apoptosis 1 OS=Drosophila melanogaster OX=7227 GN=Diap1 PE=1 SV=2
12	Q13490	1.98e-29	117	618	0.267	0.102	BIRC2_HUMAN Baculoviral IAP repeat-containing protein 2 OS=Homo sapiens OX=9606 GN=BIRC2 PE=1 SV=2
13	Q90660	6.63e-28	113	611	0.254	0.098	BIR_CHICK Inhibitor of apoptosis protein OS=Gallus gallus OX=9031 GN=ITA PE=2 SV=1
14	Q62210	3.77e-27	110	612	0.250	0.096	BIRC2_MOUSE Baculoviral IAP repeat-containing protein 2 OS=Mus musculus OX=10090 GN=Birc2 PE=1 SV=1
15	Q13489	4.16e-27	110	604	0.254	0.099	BIRC3_HUMAN Baculoviral IAP repeat-containing protein 3 OS=Homo sapiens OX=9606 GN=BIRC3 PE=1 SV=2
16	F7FLN8	4.79e-27	110	602	0.263	0.103	F7FLN8_RAT Baculoviral IAP repeat-containing 3 OS=Rattus norvegicus OX=10116 GN=Birc3 PE=3 SV=3
17	Q6P6S1	5.15e-27	110	589	0.263	0.105	Q6P6S1_RAT Baculoviral IAP repeat-containing 2 OS=Rattus norvegicus OX=10116 GN=Birc2 PE=3 SV=1
18	Q5XIW4	5.28e-27	110	602	0.263	0.103	Q5XIW4_RAT Baculoviral IAP repeat-containing 3 OS=Rattus norvegicus OX=10116 GN=Birc3 PE=2 SV=1
19	A0A0G2JTI9	5.45e-27	110	638	0.263	0.097	A0A0G2JTI9_RAT Baculoviral IAP repeat-containing 3 OS=Rattus norvegicus OX=10116 GN=Birc3 PE=3 SV=1
20	A0A8I6ADV9	6.01e-27	110	537	0.263	0.115	A0A8I6ADV9_RAT Baculoviral IAP repeat-containing 2 OS=Rattus norvegicus OX=10116 GN=Birc2 PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00653 BIR	7.6e-15	66.6	Inhibitor of Apoptosis domain
2	PF10217 DUF2039	3.1e+02	13.1	Uncharacterized conserved protein (DUF2039)
3	PF14447 Prok-RING_4	0.002	29.3	Prokaryotic RING finger family 4
4	PF13923 zf-C3HC4_2	3.6	18.8	Zinc finger, C3HC4 type (RING finger)
5	PF13920 zf-C3HC4_3	9.8e-10	49.4	Zinc finger, C3HC4 type (RING finger)
6	PF14634 zf-RING_5	1e+02	14.3	zinc-RING finger domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000412957

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000330237	0.990	Caspase-9
2	9606.ENSP00000398495	0.965	Diablo homolog, mitochondrial
3	9606.ENSP00000311032	0.815	Caspase-3
4	9606.ENSP00000216160	0.689	TGF-beta-activated kinase 1 and MAP3K7-binding protein 1
5	9606.ENSP00000448165	0.670	Apoptotic protease-activating factor 1
6	9606.ENSP00000360242	0.649	E3 ubiquitin-protein ligase XIAP
7	9606.ENSP00000258080	0.647	Serine protease HTRA2, mitochondrial
8	9606.ENSP00000351273	0.642	Caspase-8
9	9606.ENSP00000301633	0.636	Baculoviral IAP repeat containing 5
10	9606.ENSP00000302564	0.627	Bcl-2-like protein 1
11	9606.ENSP00000358327	0.598	Caspase-7
12	9606.ENSP00000354822	0.595	XIAP-associated factor 1
13	9606.ENSP00000418734	0.552	Histone H2A deubiquitinase MYSM1
14	9606.ENSP00000313950	0.539	Aurora kinase B
15	9606.ENSP00000358022	0.529	Induced myeloid leukemia cell differentiation protein Mcl-1
16	9606.ENSP00000216911	0.512	Aurora kinase A
17	9606.ENSP00000302898	0.512	Aurora kinase C

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0003824	0.955	catalytic activity
GO:0140096	0.939	catalytic activity, acting on a protein
GO:0016740	0.805	transferase activity
GO:0019899	0.472	enzyme binding
GO:0042802	0.383	identical protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.995	regulation of cellular process
GO:0080090	0.990	regulation of primary metabolic process
GO:0009987	0.986	cellular process
GO:0048519	0.983	negative regulation of biological process
GO:0060255	0.983	regulation of macromolecule metabolic process
GO:0042981	0.982	regulation of apoptotic process
GO:0051171	0.980	regulation of nitrogen compound metabolic process
GO:0071704	0.967	organic substance metabolic process
GO:0048523	0.956	negative regulation of cellular process
GO:0060548	0.950	negative regulation of cell death
GO:0030162	0.945	regulation of proteolysis
GO:0043069	0.941	negative regulation of programmed cell death
GO:0043170	0.931	macromolecule metabolic process
GO:0050896	0.919	response to stimulus
GO:2000116	0.919	regulation of cysteine-type endopeptidase activity
GO:0043066	0.912	negative regulation of apoptotic process
GO:0044238	0.878	primary metabolic process
GO:0048518	0.871	positive regulation of biological process
GO:0048522	0.861	positive regulation of cellular process
GO:0006807	0.820	nitrogen compound metabolic process
GO:0051716	0.780	cellular response to stimulus
GO:0043281	0.749	regulation of cysteine-type endopeptidase activity involved in apoptotic process
GO:0009893	0.727	positive regulation of metabolic process
GO:1901564	0.687	organonitrogen compound metabolic process
GO:0010604	0.687	positive regulation of macromolecule metabolic process
GO:0019538	0.682	protein metabolic process
GO:0048583	0.677	regulation of response to stimulus
GO:0051173	0.629	positive regulation of nitrogen compound metabolic process
GO:0010951	0.607	negative regulation of endopeptidase activity
GO:0023051	0.587	regulation of signaling
GO:0010646	0.586	regulation of cell communication
GO:2000117	0.533	negative regulation of cysteine-type endopeptidase activity
GO:0009966	0.480	regulation of signal transduction
GO:0051247	0.475	positive regulation of protein metabolic process
GO:0012501	0.459	programmed cell death
GO:0007154	0.438	cell communication
GO:0007165	0.416	signal transduction
GO:0010647	0.414	positive regulation of cell communication
GO:0048584	0.409	positive regulation of response to stimulus
GO:0023056	0.393	positive regulation of signaling
GO:0006915	0.391	apoptotic process
GO:1902531	0.381	regulation of intracellular signal transduction
GO:0044093	0.327	positive regulation of molecular function
GO:0009967	0.324	positive regulation of signal transduction
GO:0032502	0.322	developmental process
GO:0032501	0.318	multicellular organismal process
GO:0042221	0.306	response to chemical
GO:0031323	0.305	regulation of cellular metabolic process
GO:0010468	0.305	regulation of gene expression

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.999	cytosol
GO:0043231	0.981	intracellular membrane-bounded organelle
GO:0005634	0.966	nucleus
GO:0032991	0.925	protein-containing complex
GO:0031974	0.925	membrane-enclosed lumen
GO:0070013	0.896	intracellular organelle lumen
GO:0031981	0.602	nuclear lumen
GO:0005654	0.399	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.-.-.-	0.805	Transferases.

[back to server]