StarFunc result for job id Q96P11

User Input

>input (429 residues)
MGLYAAAAGVLAGVESRQGSIKGLVYSSNFQNVKQLYALVCETQRYSAVLDAVIASAGLL
RAEKKLRPHLAKVLVYELLLGKGFRGGGGRWKALLGRHQARLKAELARLKVHRGVSRNED
LLEVGSRPGPASQLPRFVRVNTLKTCSDDVVDYFKRQGFSYQGRASSLDDLRALKGKHFL
LDPLMPELLVFPAQTDLHEHPLYRAGHLILQDRASCLPAMLLDPPPGSHVIDACAAPGNK
TSHLAALLKNQGKIFAFDLDAKRLASMATLLARAGVSCCELAEEDFLAVSPSDPRYHEVH
YILLDPSCSGSGMPSRQLEEPGAGTPSPVRLHALAGFQQRALCHALTFPSLQRLVYSTCS
LCQEENEDVVRDALQQNPGAFRLAPALPAWPHRGLSTFPGAEHCLRASPETTLSSGFFVA
VIERVEVPR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q96P11	1.000	1.000	1.096E-83	429	1.000	1.000	Q96P11.pdb.gz	NSUN5_HUMAN 28S rRNA (cytosine-C(5))-methyltransferase OS=Homo sapiens OX=9606 GN=NSUN5 PE=1 SV=2
2	AFDB:Q8K4F6	0.976	0.901	1.756E-71	465	0.879	0.811	Q8K4F6.pdb.gz	NSUN5_MOUSE 28S rRNA (cytosine-C(5))-methyltransferase OS=Mus musculus OX=10090 GN=Nsun5 PE=1 SV=2
3	AFDB:Q8GYE8	0.843	0.648	3.978E-39	567	0.387	0.293	Q8GYE8.pdb.gz	NSUN5_ARATH 25S rRNA (cytosine-C(5))-methyltransferase NSUN5 OS=Arabidopsis thaliana OX=3702 GN=NSUN5 PE=1 SV=1
4	AFDB:Q9NAA7	0.812	0.795	7.895E-39	439	0.359	0.351	Q9NAA7.pdb.gz	NSUN5_CAEEL 26S rRNA (cytosine-C(5))-methyltransferase nsun-5 OS=Caenorhabditis elegans OX=6239 GN=nsun-5 PE=1 SV=2
5	AFDB:O14039	0.768	0.722	2.950E-38	460	0.385	0.359	O14039.pdb.gz	RCM1_SCHPO 25S rRNA (cytosine-C(5))-methyltransferase rcm1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rcm1 PE=3 SV=3
6	AFDB:Q9VDZ4	0.839	0.831	8.615E-37	433	0.319	0.316	Q9VDZ4.pdb.gz	NSUN5_DROME 28S rRNA (cytosine-C(5))-methyltransferase OS=Drosophila melanogaster OX=7227 GN=Nsun5 PE=2 SV=1
7	AFDB:Q384A7	0.666	0.518	2.558E-31	566	0.373	0.283	Q384A7.pdb.gz	Q384A7_TRYB2 SAM-dependent MTase RsmB/NOP-type domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.0950 PE=3 SV=1
8	AFDB:P53972	0.782	0.693	4.816E-31	490	0.326	0.286	P53972.pdb.gz	RCM1_YEAST 25S rRNA (cytosine(2278)-C(5))-methyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RCM1 PE=1 SV=1
9	AFDB:Q14AW5	0.760	0.467	8.296E-27	724	0.252	0.149	Q14AW5.pdb.gz	NSUN7_MOUSE Putative methyltransferase NSUN7 OS=Mus musculus OX=10090 GN=Nsun7 PE=2 SV=2
10	AFDB:P46087	0.580	0.315	1.079E-23	812	0.247	0.131	P46087.pdb.gz	NOP2_HUMAN Probable 28S rRNA (cytosine(4447)-C(5))-methyltransferase OS=Homo sapiens OX=9606 GN=NOP2 PE=1 SV=2
11	PDB:7nacq	0.566	0.671	8.865E-21	358	0.212	0.254	7nacq.pdb.gz	Sequence-specific remodeling of a topologically complex RNP substrate by Spb4.
12	PDB:5zveB	0.520	0.578	3.033E-19	384	0.200	0.224	5zveB.pdb.gz	Archaeal NSUN6 catalyzes m5C72 modification on a wide-range of specific tRNAs.
13	PDB:1sqfA	0.693	0.699	1.327E-18	425	0.228	0.231	1sqfA.pdb.gz	The First Structure of an RNA m5C Methyltransferase, Fmu, Provides Insight into Catalytic Mechanism and Specific Binding of RNA Substrate
14	PDB:3a4tA	0.516	0.835	4.705E-18	258	0.166	0.275	3a4tA.pdb.gz	Crystal structure of Methanocaldococcus jannaschii Trm4 complexed with sinefungin.
15	PDB:2frxA	0.569	0.537	2.978E-17	455	0.198	0.187	2frxA.pdb.gz
16	PDB:5wwrA	0.522	0.488	5.320E-17	461	0.212	0.197	5wwrA.pdb.gz	Structural basis for substrate binding and catalytic mechanism of a human RNA:m5C methyltransferase NSun6
17	PDB:7of5C	0.459	0.569	1.665E-11	338	0.145	0.183	7of5C.pdb.gz	Structural basis of GTPase-mediated mitochondrial ribosome biogenesis and recycling.
18	PDB:7r6kq	0.309	0.722	1.607E-10	177	0.119	0.288	7r6kq.pdb.gz	Sequence-specific remodeling of a topologically complex RNP substrate by Spb4.
19	PDB:7pd3x	0.500	0.579	4.613E-10	366	0.152	0.178	7pd3x.pdb.gz	Visualizing formation of the active site in the mitochondrial ribosome.
20	PDB:2bh2A	0.300	0.307	6.667E-7	418	0.091	0.093	2bh2A.pdb.gz	A Unique RNA Fold in the Ruma-RNA-Cofactor Ternary Complex Contributes to Substrate Selectivity and Enzymatic Function

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8K4F6	0.0	696	465	0.848	0.783	NSUN5_MOUSE 28S rRNA (cytosine-C(5))-methyltransferase OS=Mus musculus OX=10090 GN=Nsun5 PE=1 SV=2
2	Q96P11	0.0	869	429	1.000	1.000	NSUN5_HUMAN 28S rRNA (cytosine-C(5))-methyltransferase OS=Homo sapiens OX=9606 GN=NSUN5 PE=1 SV=2
3	Q9NAA7	2.37e-88	277	439	0.371	0.362	NSUN5_CAEEL 26S rRNA (cytosine-C(5))-methyltransferase nsun-5 OS=Caenorhabditis elegans OX=6239 GN=nsun-5 PE=1 SV=2
4	O14039	5.32e-83	264	460	0.401	0.374	RCM1_SCHPO 25S rRNA (cytosine-C(5))-methyltransferase rcm1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rcm1 PE=3 SV=3
5	Q8GYE8	5.92e-81	261	567	0.394	0.298	NSUN5_ARATH 25S rRNA (cytosine-C(5))-methyltransferase NSUN5 OS=Arabidopsis thaliana OX=3702 GN=NSUN5 PE=1 SV=1
6	Q9VDZ4	1.45e-63	213	433	0.336	0.333	NSUN5_DROME 28S rRNA (cytosine-C(5))-methyltransferase OS=Drosophila melanogaster OX=7227 GN=Nsun5 PE=2 SV=1
7	Q384A7	2.48e-52	186	566	0.380	0.288	Q384A7_TRYB2 SAM-dependent MTase RsmB/NOP-type domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.0950 PE=3 SV=1
8	P53972	8.55e-47	169	490	0.336	0.294	RCM1_YEAST 25S rRNA (cytosine(2278)-C(5))-methyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RCM1 PE=1 SV=1
9	Q9TYV5	5.80e-27	115	664	0.231	0.149	NSUN1_CAEEL 26S rRNA (cytosine-C(5))-methyltransferase nsun-1 OS=Caenorhabditis elegans OX=6239 GN=nsun-1 PE=1 SV=2
10	Q9FG73	8.03e-26	112	682	0.212	0.133	NOP2A_ARATH 25S rRNA (cytosine-C(5))-methyltransferase NOP2A OS=Arabidopsis thaliana OX=3702 GN=NOP2A PE=1 SV=1
11	Q8VYM6	1.71e-25	111	671	0.219	0.140	NOP2B_ARATH 26S rRNA (cytosine-C(5))-methyltransferase NOP2B OS=Arabidopsis thaliana OX=3702 GN=NOP2B PE=1 SV=1
12	P46087	2.10e-24	108	812	0.235	0.124	NOP2_HUMAN Probable 28S rRNA (cytosine(4447)-C(5))-methyltransferase OS=Homo sapiens OX=9606 GN=NOP2 PE=1 SV=2
13	Q922K7	1.26e-23	105	793	0.228	0.124	NOP2_MOUSE Probable 28S rRNA (cytosine-C(5))-methyltransferase OS=Mus musculus OX=10090 GN=Nop2 PE=1 SV=1
14	P40991	2.11e-23	105	618	0.203	0.141	NOP2_YEAST 25S rRNA (cytosine(2870)-C(5))-methyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=NOP2 PE=1 SV=1
15	O94268	2.68e-22	101	608	0.210	0.148	NOP2_SCHPO 25S rRNA (cytosine-C(5))-methyltransferase nop2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=nop2 PE=1 SV=1
16	Q14AW5	4.50e-22	101	724	0.273	0.162	NSUN7_MOUSE Putative methyltransferase NSUN7 OS=Mus musculus OX=10090 GN=Nsun7 PE=2 SV=2
17	Q583H8	2.38e-21	98.6	525	0.207	0.170	Q583H8_TRYB2 Nucleolar protein, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb04.30O21.90 PE=3 SV=1
18	Q9V106	1.31e-19	91.3	311	0.182	0.251	TRCM_PYRAB tRNA (cytosine(49)-C(5))-methyltransferase OS=Pyrococcus abyssi (strain GE5 / Orsay) OX=272844 GN=PYRAB06230 PE=1 SV=1
19	O57712	2.15e-19	91.7	389	0.166	0.183	NSUN6_PYRHO tRNA (cytosine(72)-C(5))-methyltransferase OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) OX=70601 GN=PH1991 PE=1 SV=1
20	Q60343	7.54e-19	88.2	274	0.184	0.288	TRM4_METJA tRNA (cytosine(48)-C(5))-methyltransferase OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) OX=243232 GN=trm4 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01728 FtsJ	8.2	18.0	FtsJ-like methyltransferase
2	PF13847 Methyltransf_31	18	16.6	Methyltransferase domain
3	PF01189 Methyltr_RsmB-F	2.5e-24	97.6	16S rRNA methyltransferase RsmB/F

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000309126

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000318986	0.864	tRNA (cytosine(34)-C(5))-methyltransferase, mitochondrial
2	9606.ENSP00000419740	0.811	5-methylcytosine rRNA methyltransferase NSUN4
3	9606.ENSP00000367030	0.762	tRNA (cytosine(38)-C(5))-methyltransferase
4	9606.ENSP00000339145	0.760	Ribosomal RNA processing protein 1 homolog B
5	9606.ENSP00000199320	0.757	Probable dimethyladenosine transferase
6	9606.ENSP00000354812	0.717	Putative methyltransferase C9orf114
7	9606.ENSP00000308179	0.710	WD repeat-containing protein 3
8	9606.ENSP00000401191	0.702	Probable 18S rRNA (guanine-N(7))-methyltransferase
9	9606.ENSP00000297990	0.676	Nucleolar protein 6
10	9606.ENSP00000254605	0.673	Ribosomal RNA-processing protein 8
11	9606.ENSP00000252037	0.671	Inactive peptidyl-prolyl cis-trans isomerase FKBP6
12	9606.ENSP00000397566	0.663	General transcription factor II-I repeat domain-containing protein 1
13	9606.ENSP00000309334	0.662	Ribosomal protein L15
14	9606.ENSP00000481559	0.656	rRNA methyltransferase 1, mitochondrial
15	9606.ENSP00000317232	0.649	Peptidyl-prolyl cis-trans isomerase FKBP10
16	9606.ENSP00000318966	0.648	PIN2/TERF1-interacting telomerase inhibitor 1
17	9606.ENSP00000307260	0.638	Transducin beta-like protein 2
18	9606.ENSP00000265753	0.636	Eukaryotic translation initiation factor 4H
19	9606.ENSP00000254940	0.635	60S ribosome subunit biogenesis protein NIP7 homolog
20	9606.ENSP00000380982	0.633	Pumilio homolog 3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0008169	1.000	C-methyltransferase activity
GO:0008649	1.000	rRNA methyltransferase activity
GO:0003723	0.997	RNA binding
GO:0009383	0.991	rRNA (cytosine-C5-)-methyltransferase activity
GO:0005515	0.459	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.995	cellular process
GO:0034470	0.992	ncRNA processing
GO:0001510	0.992	RNA methylation
GO:0080090	0.979	regulation of primary metabolic process
GO:0051171	0.979	regulation of nitrogen compound metabolic process
GO:0010468	0.979	regulation of gene expression
GO:0010604	0.968	positive regulation of macromolecule metabolic process
GO:0031323	0.965	regulation of cellular metabolic process
GO:0010556	0.963	regulation of macromolecule biosynthetic process
GO:0031326	0.963	regulation of cellular biosynthetic process
GO:0022613	0.961	ribonucleoprotein complex biogenesis
GO:0031167	0.935	rRNA methylation
GO:0051173	0.930	positive regulation of nitrogen compound metabolic process
GO:0051246	0.929	regulation of protein metabolic process
GO:0031325	0.922	positive regulation of cellular metabolic process
GO:0010608	0.912	post-transcriptional regulation of gene expression
GO:0010557	0.901	positive regulation of macromolecule biosynthetic process
GO:0031328	0.896	positive regulation of cellular biosynthetic process
GO:0045727	0.882	positive regulation of translation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.999	nucleoplasm
GO:0005730	0.998	nucleolus
GO:0005737	0.665	cytoplasm
GO:0032991	0.363	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.1.1.-	1.000	Methyltransferases.

[back to server]