StarFunc result for job id Q96P16

User Input

>input (312 residues)
MSAFSEAALEKKLSELSNSQQSVQTLSLWLIHHRKHSRPIVTVWERELRKAKPNRKLTFL
YLANDVIQNSKRKGPEFTKDFAPVIVEAFKHVSSETDESCKKHLGRVLSIWEERSVYEND
VLEQLKQALYGDKKPRKRTYEQIKVDENENCSSLGSPSEPPQTLDLVRALQDLENAASGD
AAVHQRIASLPVEVQEVSLLDKITDKESGERLSKMVEDACMLLADYNGRLAAEIDDRKQL
TRMLADFLRCQKEALAEKEHKLEEYKRKLARVSLVRKELRSRIQSLPDLSRLPNVTGSHM
HLPFAGDIYSED

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q96P16	1.000	1.000	4.928E-41	312	1.000	1.000	Q96P16.pdb.gz	RPR1A_HUMAN Regulation of nuclear pre-mRNA domain-containing protein 1A OS=Homo sapiens OX=9606 GN=RPRD1A PE=1 SV=1
2	AFDB:Q9NQG5	0.453	0.435	3.822E-29	326	0.683	0.653	Q9NQG5.pdb.gz	RPR1B_HUMAN Regulation of nuclear pre-mRNA domain-containing protein 1B OS=Homo sapiens OX=9606 GN=RPRD1B PE=1 SV=1
3	AFDB:P34281	0.402	0.398	5.904E-15	315	0.244	0.241	P34281.pdb.gz	CIDS1_CAEEL CID domain-containing protein 1 OS=Caenorhabditis elegans OX=6239 GN=cids-1 PE=4 SV=2
4	AFDB:Q5VT52	0.389	0.087	4.064E-12	1461	0.279	0.060	Q5VT52.pdb.gz	RPRD2_HUMAN Regulation of nuclear pre-mRNA domain-containing protein 2 OS=Homo sapiens OX=9606 GN=RPRD2 PE=1 SV=1
5	AFDB:A0A0P0WFI1	0.397	0.237	1.545E-11	528	0.276	0.163	A0A0P0WFI1.pdb.gz	A0A0P0WFI1_ORYSJ Os04g0636700 protein OS=Oryza sativa subsp. japonica OX=39947 GN=Os04g0636700 PE=1 SV=1
6	AFDB:O74814	0.410	0.332	3.958E-10	387	0.199	0.160	O74814.pdb.gz	YJ03_SCHPO UPF0400 protein C337.03 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC337.03 PE=1 SV=1
7	AFDB:Q05543	0.405	0.311	3.077E-9	409	0.202	0.154	Q05543.pdb.gz	RT103_YEAST Regulator of Ty1 transposition protein 103 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RTT103 PE=1 SV=1
8	AFDB:A5Z2V1	0.392	0.189	1.350E-8	664	0.170	0.080	A5Z2V1.pdb.gz	A5Z2V1_CAEEL CID domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=cids-2 PE=1 SV=1
9	AFDB:P39081	0.389	0.204	3.412E-6	626	0.157	0.078	P39081.pdb.gz	PCF11_YEAST Protein PCF11 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PCF11 PE=1 SV=2
10	AFDB:Q9UPN6	0.386	0.099	7.677E-6	1271	0.141	0.035	Q9UPN6.pdb.gz	SCAF8_HUMAN SR-related and CTD-associated factor 8 OS=Homo sapiens OX=9606 GN=SCAF8 PE=1 SV=1
11	PDB:7dkhI	0.146	0.067	4.024E-1	914	0.080	0.027	7dkhI.pdb.gz
12	PDB:7oo3c	0.304	0.604	4.870E-1	141	0.048	0.106	7oo3c.pdb.gz	Structural basis of human transcription-DNA repair coupling.
13	PDB:6jxcA	0.147	0.034	6.483E-1	2345	0.106	0.014	6jxcA.pdb.gz
14	PDB:1wa5B	0.242	0.174	7.846E-1	466	0.054	0.036	1wa5B.pdb.gz	Structural basis for the assembly of a nuclear export complex.
15	PDB:4xnhA	0.222	0.104	8.229E-1	786	0.125	0.050	4xnhA.pdb.gz	Crystal structure of yeast N-terminal acetyltransferase NatE (IP6) in complex with a bisubstrate
16	PDB:4hm9A	0.222	0.162	8.631E-1	511	0.122	0.074	4hm9A.pdb.gz
17	PDB:4r0zA	0.146	0.093	9.495E-1	557	0.083	0.047	4r0zA.pdb.gz
18	PDB:6yleC	0.220	0.135	9.958E-1	545	0.054	0.031	6yleC.pdb.gz	Construction of the Central Protuberance and L1 Stalk during 60S Subunit Biogenesis.
19	PDB:5ok9B	0.139	0.173	1.096	242	0.083	0.107	5ok9B.pdb.gz
20	PDB:6xu2A	0.264	0.088	1.096	1091	0.074	0.021	6xu2A.pdb.gz	X-ray Structure of the Human Karyopherin RanBP5, an Essential Factor for Influenza Polymerase Nuclear Trafficking.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q96P16	0.0	639	312	1.000	1.000	RPR1A_HUMAN Regulation of nuclear pre-mRNA domain-containing protein 1A OS=Homo sapiens OX=9606 GN=RPRD1A PE=1 SV=1
2	Q9NQG5	1.20e-139	399	326	0.683	0.653	RPR1B_HUMAN Regulation of nuclear pre-mRNA domain-containing protein 1B OS=Homo sapiens OX=9606 GN=RPRD1B PE=1 SV=1
3	A0A0P0WFI1	1.29e-28	117	528	0.173	0.102	A0A0P0WFI1_ORYSJ Os04g0636700 protein OS=Oryza sativa subsp. japonica OX=39947 GN=Os04g0636700 PE=1 SV=1
4	P34281	4.63e-25	104	315	0.240	0.238	CIDS1_CAEEL CID domain-containing protein 1 OS=Caenorhabditis elegans OX=6239 GN=cids-1 PE=4 SV=2
5	Q5VT52	5.10e-22	99.0	1461	0.285	0.061	RPRD2_HUMAN Regulation of nuclear pre-mRNA domain-containing protein 2 OS=Homo sapiens OX=9606 GN=RPRD2 PE=1 SV=1
6	Q05543	1.35e-11	67.0	409	0.128	0.098	RT103_YEAST Regulator of Ty1 transposition protein 103 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RTT103 PE=1 SV=1
7	O74814	2.16e-10	63.2	387	0.215	0.173	YJ03_SCHPO UPF0400 protein C337.03 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC337.03 PE=1 SV=1
8	Q8I4J5	3.90e-05	47.4	656	0.093	0.044	Q8I4J5_CAEEL CID domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=cids-2 PE=1 SV=2
9	Q9XVN9	3.97e-05	47.4	658	0.093	0.044	Q9XVN9_CAEEL CID domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=cids-2 PE=1 SV=2
10	A5Z2V0	4.05e-05	47.4	662	0.093	0.044	A5Z2V0_CAEEL CID domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=cids-2 PE=1 SV=1
11	A5Z2V1	1.23e-04	45.8	664	0.083	0.039	A5Z2V1_CAEEL CID domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=cids-2 PE=1 SV=1
12	Q55CI7	1.49e-04	45.4	595	0.096	0.050	Q55CI7_DICDI RNA-binding region RNP-1 domain-containing protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0271014 PE=4 SV=1
13	Q5U393	1.57e-04	45.8	1457	0.090	0.019	Q5U393_DANRE Cleavage and polyadenylation factor subunit, homolog (S. cerevisiae) OS=Danio rerio OX=7955 GN=zgc:175013 PE=1 SV=1
14	O94913	0.002	42.0	1555	0.083	0.017	PCF11_HUMAN Pre-mRNA cleavage complex 2 protein Pcf11 OS=Homo sapiens OX=9606 GN=PCF11 PE=1 SV=3
15	Q63627	0.004	41.6	1200	0.074	0.019	SCAF4_RAT SR-related and CTD-associated factor 4 OS=Rattus norvegicus OX=10116 GN=Scaf4 PE=1 SV=2
16	Q10237	0.012	39.7	638	0.080	0.039	YD14_SCHPO Uncharacterized protein C4G9.04c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC4G9.04c PE=4 SV=1
17	O95104	0.014	39.7	1147	0.096	0.026	SCAF4_HUMAN SR-related and CTD-associated factor 4 OS=Homo sapiens OX=9606 GN=SCAF4 PE=1 SV=3
18	A0A0A0MT33	0.027	38.9	1349	0.103	0.024	A0A0A0MT33_HUMAN SR-related CTD associated factor 8 OS=Homo sapiens OX=9606 GN=SCAF8 PE=1 SV=1
19	Q9UPN6	0.028	38.5	1271	0.103	0.025	SCAF8_HUMAN SR-related and CTD-associated factor 8 OS=Homo sapiens OX=9606 GN=SCAF8 PE=1 SV=1
20	Q8IWX8	0.13	36.6	916	0.061	0.021	CHERP_HUMAN Calcium homeostasis endoplasmic reticulum protein OS=Homo sapiens OX=9606 GN=CHERP PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF04818 CID	2.8e-35	132.6	CID domain
2	PF16566 CREPT	1.1e-55	199.2	Cell-cycle alteration and expression-elevated protein in tumour
3	PF12243 CTK3	51	15.3	CTD kinase subunit gamma CTK3
4	PF05201 GlutR_N	3.1e+02	12.5	Glutamyl-tRNAGlu reductase, N-terminal domain
5	PF01895 PhoU	3.1e+02	13.2	PhoU domain
6	PF13206 VSG_B	2.9e+02	11.9	Trypanosomal VSG domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 482537.XP_008576889.1

Rank	PPI partner	STRING score	Description
1	482537.XP_008572076.1	0.950	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 6 mRNAs, 10 Proteins, and 94% coverage of the annotated genomic feature by RNAseq alignments, including 2 samples with support for all annotated introns
2	482537.XP_008584956.1	0.910	Putative RNA polymerase II subunit B1 CTD phosphatase RPAP2
3	482537.XP_008573782.1	0.909	Regulation of nuclear pre-mRNA domain-containing protein 1B
4	482537.XP_008573017.1	0.857	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 4 mRNAs, 12 Proteins, and 99% coverage of the annotated genomic feature by RNAseq alignments, including 2 samples with support for all annotated introns
5	482537.XP_008575403.1	0.857	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 mRNA, 12 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 2 samples with support for all annotated introns
6	482537.XP_008576090.1	0.851	DNA-directed RNA polymerase II subunit RPB2
7	482537.XP_008583116.1	0.840	Regulation of nuclear pre-mRNA domain-containing protein 2
8	482537.XP_008566448.1	0.829	pre-mRNA cleavage complex 2 protein Pcf11 isoform X1
9	482537.XP_008571722.1	0.804	DNA-directed RNA polymerase II subunit RPB7
10	482537.XP_008576573.1	0.795	DNA-directed RNA polymerase II subunit RPB4
11	482537.XP_008573593.1	0.792	Von Willebrand factor A domain-containing protein 9
12	482537.XP_008587897.1	0.792	DNA-directed RNA polymerases I, II, and III subunit RPABC5
13	482537.XP_008588509.1	0.792	Protein asunder homolog
14	482537.XP_008573876.1	0.789	DNA-directed RNA polymerase II subunit RPB9
15	482537.XP_008586237.1	0.786	DNA-directed RNA polymerases I, II, and III subunit RPABC1
16	482537.XP_008592721.1	0.761	DNA-directed RNA polymerase II subunit RPB11-a
17	482537.XP_008576383.1	0.759	RNA polymerase II subunit A C-terminal domain phosphatase SSU72
18	482537.XP_008576876.1	0.759	RNA polymerase II subunit A C-terminal domain phosphatase SSU72-like
19	482537.XP_008565694.1	0.757	UBX domain-containing protein 7 isoform X1
20	482537.XP_008592776.1	0.753	Protein FAM71B-like

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0042802	1.000	identical protein binding
GO:0001099	0.611	basal RNA polymerase II transcription machinery binding
GO:0070063	0.602	RNA polymerase binding
GO:0043175	0.586	RNA polymerase core enzyme binding
GO:0000993	0.583	RNA polymerase II complex binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.997	organic substance metabolic process
GO:0050789	0.997	regulation of biological process
GO:0044237	0.996	cellular metabolic process
GO:0044238	0.993	primary metabolic process
GO:0006807	0.993	nitrogen compound metabolic process
GO:0050794	0.993	regulation of cellular process
GO:0043412	0.989	macromolecule modification
GO:0006793	0.989	phosphorus metabolic process
GO:0019538	0.982	protein metabolic process
GO:0010556	0.977	regulation of macromolecule biosynthetic process
GO:0031326	0.976	regulation of cellular biosynthetic process
GO:0051252	0.976	regulation of RNA metabolic process
GO:0006355	0.972	regulation of DNA-templated transcription
GO:0006796	0.968	phosphate-containing compound metabolic process
GO:0006357	0.961	regulation of transcription by RNA polymerase II
GO:0006470	0.946	protein dephosphorylation
GO:0048518	0.343	positive regulation of biological process
GO:0048522	0.327	positive regulation of cellular process
GO:0046483	0.318	heterocycle metabolic process
GO:1901360	0.303	organic cyclic compound metabolic process
GO:0006725	0.301	cellular aromatic compound metabolic process
GO:0034641	0.301	cellular nitrogen compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016591	1.000	RNA polymerase II, holoenzyme
GO:0005737	0.750	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]