StarFunc result for job id Q96P20

User Input

>input (1036 residues)
MKMASTRCKLARYLEDLEDVDLKKFKMHLEDYPPQKGCIPLPRGQTEKADHVDLATLMID
FNGEEKAWAMAVWIFAAINRRDLYEKAKRDEPKWGSDNARVSNPTVICQEDSIEEEWMGL
LEYLSRISICKMKKDYRKKYRKYVRSRFQCIEDRNARLGESVSLNKRYTRLRLIKEHRSQ
QEREQELLAIGKTKTCESPVSPIKMELLFDPDDEHSEPVHTVVFQGAAGIGKTILARKMM
LDWASGTLYQDRFDYLFYIHCREVSLVTQRSLGDLIMSCCPDPNPPIHKIVRKPSRILFL
MDGFDELQGAFDEHIGPLCTDWQKAERGDILLSSLIRKKLLPEASLLITTRPVALEKLQH
LLDHPRHVEILGFSEAKRKEYFFKYFSDEAQARAAFSLIQENEVLFTMCFIPLVCWIVCT
GLKQQMESGKSLAQTSKTTTAVYVFFLSSLLQPRGGSQEHGLCAHLWGLCSLAADGIWNQ
KILFEESDLRNHGLQKADVSAFLRMNLFQKEVDCEKFYSFIHMTFQEFFAAMYYLLEEEK
EGRTNVPGSRLKLPSRDVTVLLENYGKFEKGYLIFVVRFLFGLVNQERTSYLEKKLSCKI
SQQIRLELLKWIEVKAKAKKLQIQPSQLELFYCLYEMQEEDFVQRAMDYFPKIEINLSTR
MDHMVSSFCIENCHRVESLSLGFLHNMPKEEEEEEKEGRHLDMVQCVLPSSSHAACSHGL
VNSHLTSSFCRGLFSVLSTSQSLTELDLSDNSLGDPGMRVLCETLQHPGCNIRRLWLGRC
GLSHECCFDISLVLSSNQKLVELDLSDNALGDFGIRLLCVGLKHLLCNLKKLWLVSCCLT
SACCQDLASVLSTSHSLTRLYVGENALGDSGVAILCEKAKNPQCNLQKLGLVNSGLTSVC
CSALSSVLSTNQNLTHLYLRGNTLGDKGIKLLCEGLLHPDCKLQVLELDNCNLTSHCCWD
LSTLLTSSQSLRKLSLGNNDLGDLGVMMFCEVLKQQSCLLQNLGLSEMYFNYETKSALET
LQEEKPELTVVFEPSW

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:7pzcA	0.537	0.550	0.000	1010	0.969	0.994	7pzcA.pdb.gz	Structure of the NLRP3 decamer bound to the cytokine release inhibitor CRID3.
2	AFDB:D4A523	0.662	0.663	0.000	1035	0.820	0.821	D4A523.pdb.gz	NLRP3_RAT NACHT, LRR and PYD domains-containing protein 3 OS=Rattus norvegicus OX=10116 GN=Nlrp3 PE=3 SV=2
3	AFDB:Q96P20	1.000	1.000	0.000	1036	1.000	1.000	Q96P20.pdb.gz	NLRP3_HUMAN NACHT, LRR and PYD domains-containing protein 3 OS=Homo sapiens OX=9606 GN=NLRP3 PE=1 SV=3
4	AFDB:P59046	0.498	0.487	1.797E-85	1061	0.476	0.465	P59046.pdb.gz	NAL12_HUMAN NACHT, LRR and PYD domains-containing protein 12 OS=Homo sapiens OX=9606 GN=NLRP12 PE=1 SV=2
5	AFDB:E9Q5R7	0.492	0.484	3.348E-81	1054	0.450	0.442	E9Q5R7.pdb.gz	NAL12_MOUSE NACHT, LRR and PYD domains-containing protein 12 OS=Mus musculus OX=10090 GN=Nlrp12 PE=1 SV=1
6	PDB:7lfhA	0.498	0.627	1.995E-68	806	0.659	0.847	7lfhA.pdb.gz
7	AFDB:Q86W24	0.327	0.314	8.925E-67	1093	0.369	0.349	Q86W24.pdb.gz	NAL14_HUMAN NACHT, LRR and PYD domains-containing protein 14 OS=Homo sapiens OX=9606 GN=NLRP14 PE=1 SV=1
8	PDB:6npyA	0.392	0.491	6.171E-65	798	0.746	0.969	6npyA.pdb.gz	Structural mechanism for NEK7-licensed activation of NLRP3 inflammasome.
9	AFDB:Q7RTR0	0.413	0.428	2.899E-62	991	0.318	0.332	Q7RTR0.pdb.gz	NLRP9_HUMAN NACHT, LRR and PYD domains-containing protein 9 OS=Homo sapiens OX=9606 GN=NLRP9 PE=1 SV=1
10	AFDB:P59047	0.303	0.271	7.748E-62	1200	0.298	0.258	P59047.pdb.gz	NALP5_HUMAN NACHT, LRR and PYD domains-containing protein 5 OS=Homo sapiens OX=9606 GN=NLRP5 PE=1 SV=2
11	AFDB:Q96MN2	0.388	0.401	3.480E-60	994	0.327	0.341	Q96MN2.pdb.gz	NALP4_HUMAN NACHT, LRR and PYD domains-containing protein 4 OS=Homo sapiens OX=9606 GN=NLRP4 PE=1 SV=3
12	AFDB:F1MT67	0.330	0.316	4.928E-59	1098	0.310	0.292	F1MT67.pdb.gz	F1MT67_BOVIN NLR family pyrin domain containing 5 OS=Bos taurus OX=9913 GN=NLRP5 PE=3 SV=3
13	AFDB:Q9NX02	0.450	0.441	3.521E-58	1062	0.325	0.317	Q9NX02.pdb.gz	NALP2_HUMAN NACHT, LRR and PYD domains-containing protein 2 OS=Homo sapiens OX=9606 GN=NLRP2 PE=1 SV=1
14	PDB:4kxfP	0.307	0.352	2.026E-22	866	0.155	0.186	4kxfP.pdb.gz	Crystal structure of NLRC4 reveals its autoinhibition mechanism
15	PDB:1a4yA	0.346	0.755	2.303E-22	460	0.124	0.278	1a4yA.pdb.gz
16	PDB:3jblA	0.371	0.407	6.147E-15	909	0.153	0.174	3jblA.pdb.gz
17	PDB:6b5bA	0.344	0.303	7.029E-14	1199	0.151	0.130	6b5bA.pdb.gz
18	PDB:5yudA	0.341	0.298	8.182E-10	1238	0.144	0.120	5yudA.pdb.gz	Structural basis for specific flagellin recognition by the NLR protein NAIP5.
19	PDB:6o60C	0.251	0.575	3.979E-9	389	0.076	0.203	6o60C.pdb.gz	GGTase3 is a newly identified geranylgeranyltransferase targeting a ubiquitin ligase.
20	PDB:6j5wA	0.175	0.211	3.394E-7	816	0.129	0.164	6j5wA.pdb.gz	Ligand-triggered allosteric ADP release primes a plant NLR complex.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	D4A523	0.0	1722	1035	0.821	0.822	NLRP3_RAT NACHT, LRR and PYD domains-containing protein 3 OS=Rattus norvegicus OX=10116 GN=Nlrp3 PE=3 SV=2
2	E9Q5R7	0.0	829	1054	0.463	0.455	NAL12_MOUSE NACHT, LRR and PYD domains-containing protein 12 OS=Mus musculus OX=10090 GN=Nlrp12 PE=1 SV=1
3	P59046	0.0	900	1061	0.486	0.475	NAL12_HUMAN NACHT, LRR and PYD domains-containing protein 12 OS=Homo sapiens OX=9606 GN=NLRP12 PE=1 SV=2
4	Q86W24	0.0	614	1093	0.371	0.351	NAL14_HUMAN NACHT, LRR and PYD domains-containing protein 14 OS=Homo sapiens OX=9606 GN=NLRP14 PE=1 SV=1
5	Q8R4B8	0.0	1741	1033	0.827	0.830	NLRP3_MOUSE NACHT, LRR and PYD domains-containing protein 3 OS=Mus musculus OX=10090 GN=Nlrp3 PE=1 SV=1
6	Q96P20	0.0	2135	1036	1.000	1.000	NLRP3_HUMAN NACHT, LRR and PYD domains-containing protein 3 OS=Homo sapiens OX=9606 GN=NLRP3 PE=1 SV=3
7	Q96MN2	1.62e-171	530	994	0.340	0.354	NALP4_HUMAN NACHT, LRR and PYD domains-containing protein 4 OS=Homo sapiens OX=9606 GN=NLRP4 PE=1 SV=3
8	Q7RTR0	1.86e-161	504	991	0.328	0.343	NLRP9_HUMAN NACHT, LRR and PYD domains-containing protein 9 OS=Homo sapiens OX=9606 GN=NLRP9 PE=1 SV=1
9	Q9NX02	1.26e-152	483	1062	0.339	0.331	NALP2_HUMAN NACHT, LRR and PYD domains-containing protein 2 OS=Homo sapiens OX=9606 GN=NLRP2 PE=1 SV=1
10	J3KN39	4.75e-152	481	1059	0.345	0.337	J3KN39_HUMAN NACHT, LRR and PYD domains-containing protein 2 OS=Homo sapiens OX=9606 GN=NLRP2 PE=1 SV=1
11	F1MT67	1.21e-148	473	1098	0.319	0.301	F1MT67_BOVIN NLR family pyrin domain containing 5 OS=Bos taurus OX=9913 GN=NLRP5 PE=3 SV=3
12	Q647I9	3.31e-148	472	1098	0.319	0.301	NALP5_BOVIN NACHT, LRR and PYD domains-containing protein 5 OS=Bos taurus OX=9913 GN=NLRP5 PE=2 SV=1
13	P59047	1.10e-141	457	1200	0.304	0.263	NALP5_HUMAN NACHT, LRR and PYD domains-containing protein 5 OS=Homo sapiens OX=9606 GN=NLRP5 PE=1 SV=2
14	Q9C000	6.60e-139	455	1473	0.274	0.193	NLRP1_HUMAN NACHT, LRR and PYD domains-containing protein 1 OS=Homo sapiens OX=9606 GN=NLRP1 PE=1 SV=1
15	Q66X03	2.34e-137	439	949	0.310	0.338	NLR9A_MOUSE NACHT, LRR and PYD domains-containing protein 9A OS=Mus musculus OX=10090 GN=Nlrp9a PE=1 SV=1
16	Q8WX94	2.05e-132	427	980	0.316	0.334	NALP7_HUMAN NACHT, LRR and PYD domains-containing protein 7 OS=Homo sapiens OX=9606 GN=NLRP7 PE=1 SV=1
17	Q66X22	3.40e-126	411	1003	0.302	0.312	NLR9B_MOUSE NACHT, LRR and PYD domains-containing protein 9B OS=Mus musculus OX=10090 GN=Nlrp9b PE=1 SV=1
18	Q3UWL9	1.86e-124	405	944	0.286	0.314	Q3UWL9_MOUSE NACHT, LRR and PYD domains-containing protein 4F OS=Mus musculus OX=10090 GN=Nlrp4g PE=2 SV=1
19	Q91WS2	6.92e-123	398	869	0.289	0.344	NLRP6_MOUSE NACHT, LRR and PYD domains-containing protein 6 OS=Mus musculus OX=10090 GN=Nlrp6 PE=1 SV=3
20	P59044	1.09e-120	393	892	0.281	0.326	NLRP6_HUMAN NACHT, LRR and PYD domains-containing protein 6 OS=Homo sapiens OX=9606 GN=NLRP6 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF14484 FISNA	2e-16	71.2	Fish-specific NACHT associated domain
2	PF00560 LRR_1	29	16.5	Leucine Rich Repeat
3	PF12799 LRR_4	0.0069	28.0	Leucine Rich repeats (2 copies)
4	PF13516 LRR_6	4.2e-16	68.6	Leucine Rich repeat
5	PF13855 LRR_8	2.8e+02	12.7	Leucine rich repeat
6	PF05729 NACHT	2.9e-45	165.7	NACHT domain
7	PF17776 NLRC4_HD2	1.2e-26	105.2	NLRC4 helical domain HD2
8	PF17779 NOD2_WH	4.4e-15	67.0	NOD2 winged helix domain
9	PF02758 PYRIN	1.7e-18	77.9	PAAD/DAPIN/Pyrin domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000337383

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000247470	0.999	Apoptosis-associated speck-like protein containing a CARD
2	9606.ENSP00000356355	0.999	Serine/threonine-protein kinase Nek7
3	9606.ENSP00000433138	0.999	Caspase-1
4	9606.ENSP00000225296	0.998	Putative ATP-dependent RNA helicase DHX33
5	9606.ENSP00000357112	0.998	Interferon-inducible protein AIM2
6	9606.ENSP00000385090	0.998	NLR family CARD domain-containing protein 4
7	9606.ENSP00000401980	0.998	Mitochondrial antiviral-signaling protein
8	9606.ENSP00000462521	0.998	Thioredoxin-interacting protein
9	9606.ENSP00000345672	0.997	Cathepsin B
10	9606.ENSP00000335153	0.996	Heat shock protein HSP 90-alpha
11	9606.ENSP00000363641	0.995	Thioredoxin
12	9606.ENSP00000375767	0.994	Caspase recruitment domain-containing protein 8
13	9606.ENSP00000235329	0.987	Mitofusin-2
14	9606.ENSP00000263341	0.986	Interleukin-1 beta
15	9606.ENSP00000376849	0.985	Caspase-5
16	9606.ENSP00000403701	0.983	Beta-arrestin-2
17	9606.ENSP00000359488	0.975	Guanylate-binding protein 5
18	9606.ENSP00000370343	0.968	Interferon regulatory factor 4
19	9606.ENSP00000433209	0.965	Gasdermin-D
20	9606.ENSP00000308351	0.932	Mixed lineage kinase domain-like protein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003674	1.000	molecular_function
GO:0005515	0.993	protein binding
GO:1901363	0.948	heterocyclic compound binding
GO:0097159	0.943	organic cyclic compound binding
GO:0003824	0.915	catalytic activity
GO:0016787	0.890	hydrolase activity
GO:0097367	0.831	carbohydrate derivative binding
GO:0043167	0.611	ion binding
GO:0016462	0.598	pyrophosphatase activity
GO:0140299	0.589	small molecule sensor activity
GO:0035591	0.583	signaling adaptor activity
GO:0017111	0.554	ribonucleoside triphosphate phosphatase activity
GO:0043168	0.551	anion binding
GO:0016887	0.536	ATP hydrolysis activity
GO:0036094	0.514	small molecule binding
GO:0000166	0.474	nucleotide binding
GO:0003676	0.458	nucleic acid binding
GO:0008289	0.424	lipid binding
GO:0017076	0.412	purine nucleotide binding
GO:0070273	0.374	phosphatidylinositol-4-phosphate binding
GO:0042802	0.323	identical protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050896	0.993	response to stimulus
GO:0048518	0.992	positive regulation of biological process
GO:0048583	0.991	regulation of response to stimulus
GO:0010468	0.991	regulation of gene expression
GO:0009987	0.989	cellular process
GO:0051239	0.988	regulation of multicellular organismal process
GO:0050794	0.987	regulation of cellular process
GO:0010604	0.982	positive regulation of macromolecule metabolic process
GO:0080090	0.981	regulation of primary metabolic process
GO:0001817	0.981	regulation of cytokine production
GO:0051171	0.979	regulation of nitrogen compound metabolic process
GO:0006950	0.973	response to stress
GO:0051716	0.973	cellular response to stimulus
GO:0065009	0.967	regulation of molecular function
GO:0051240	0.966	positive regulation of multicellular organismal process
GO:0009605	0.959	response to external stimulus
GO:0001819	0.958	positive regulation of cytokine production
GO:2000116	0.955	regulation of cysteine-type endopeptidase activity
GO:0032101	0.954	regulation of response to external stimulus
GO:0032731	0.952	positive regulation of interleukin-1 beta production
GO:0009607	0.951	response to biotic stimulus
GO:0044419	0.949	biological process involved in interspecies interaction between organisms
GO:0042221	0.947	response to chemical
GO:0080134	0.945	regulation of response to stress
GO:0031347	0.941	regulation of defense response
GO:0006954	0.936	inflammatory response
GO:0051707	0.935	response to other organism
GO:0010950	0.935	positive regulation of endopeptidase activity
GO:0031323	0.925	regulation of cellular metabolic process
GO:0048519	0.916	negative regulation of biological process
GO:0010033	0.913	response to organic substance
GO:0031349	0.911	positive regulation of defense response
GO:0070887	0.906	cellular response to chemical stimulus
GO:0019219	0.899	regulation of nucleobase-containing compound metabolic process
GO:0009889	0.888	regulation of biosynthetic process
GO:0050727	0.881	regulation of inflammatory response
GO:0071310	0.877	cellular response to organic substance
GO:0031326	0.876	regulation of cellular biosynthetic process
GO:0051252	0.876	regulation of RNA metabolic process
GO:0032103	0.875	positive regulation of response to external stimulus
GO:0009617	0.874	response to bacterium
GO:0010556	0.865	regulation of macromolecule biosynthetic process
GO:0023051	0.864	regulation of signaling
GO:0010646	0.864	regulation of cell communication
GO:0048522	0.864	positive regulation of cellular process
GO:0051090	0.858	regulation of DNA-binding transcription factor activity
GO:1901700	0.857	response to oxygen-containing compound
GO:0009615	0.854	response to virus
GO:0002682	0.849	regulation of immune system process
GO:0002237	0.847	response to molecule of bacterial origin
GO:0002376	0.845	immune system process
GO:0016043	0.835	cellular component organization
GO:0044092	0.830	negative regulation of molecular function
GO:0009966	0.826	regulation of signal transduction
GO:2001056	0.811	positive regulation of cysteine-type endopeptidase activity
GO:0043281	0.789	regulation of cysteine-type endopeptidase activity involved in apoptotic process
GO:0001818	0.785	negative regulation of cytokine production
GO:0032496	0.784	response to lipopolysaccharide
GO:0071216	0.783	cellular response to biotic stimulus
GO:1902531	0.780	regulation of intracellular signal transduction
GO:0071219	0.771	cellular response to molecule of bacterial origin
GO:0050729	0.748	positive regulation of inflammatory response
GO:0043433	0.737	negative regulation of DNA-binding transcription factor activity
GO:0098542	0.736	defense response to other organism
GO:0071222	0.733	cellular response to lipopolysaccharide
GO:0002684	0.721	positive regulation of immune system process
GO:0051606	0.714	detection of stimulus
GO:0043280	0.702	positive regulation of cysteine-type endopeptidase activity involved in apoptotic process
GO:0048585	0.681	negative regulation of response to stimulus
GO:0051260	0.662	protein homooligomerization
GO:0048523	0.655	negative regulation of cellular process
GO:0050793	0.504	regulation of developmental process
GO:0009968	0.430	negative regulation of signal transduction
GO:0031325	0.425	positive regulation of cellular metabolic process
GO:0007165	0.406	signal transduction
GO:0032501	0.381	multicellular organismal process
GO:0008152	0.365	metabolic process
GO:0050776	0.364	regulation of immune response
GO:0071704	0.352	organic substance metabolic process
GO:0009967	0.348	positive regulation of signal transduction
GO:0032088	0.308	negative regulation of NF-kappaB transcription factor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0043231	1.000	intracellular membrane-bounded organelle
GO:0032991	0.998	protein-containing complex
GO:0043228	0.988	non-membrane-bounded organelle
GO:0016020	0.987	membrane
GO:0061702	0.976	inflammasome complex
GO:0012505	0.966	endomembrane system
GO:0043232	0.966	intracellular non-membrane-bounded organelle
GO:0005634	0.898	nucleus
GO:0005739	0.893	mitochondrion
GO:0005856	0.745	cytoskeleton
GO:0071944	0.673	cell periphery
GO:0015630	0.585	microtubule cytoskeleton
GO:0070013	0.520	intracellular organelle lumen
GO:0005815	0.503	microtubule organizing center
GO:0005886	0.496	plasma membrane
GO:0072559	0.478	NLRP3 inflammasome complex
GO:0031090	0.444	organelle membrane
GO:0005794	0.417	Golgi apparatus
GO:0031981	0.395	nuclear lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.-.-.-	0.890	Hydrolases.
EC:3.6.1.-	0.598	In phosphorus-containing anhydrides.
RHEA:23680	0.554	a ribonucleoside 5'-triphosphate + H2O = a ribonucleoside 5'-diphosphate + H(+) + phosphate
EC:3.6.1.15	0.554	nucleoside-triphosphate phosphatase.
RHEA:13065	0.536	ATP + H2O = ADP + H(+) + phosphate

[back to server]