StarFunc result for job id Q96P31

User Input

>input (734 residues)
MLLWLLLLILTPGREQSGVAPKAVLLLNPPWSTAFKGEKVALICSSISHSLAQGDTYWYH
DEKLLKIKHDKIQITEPGNYQCKTRGSSLSDAVHVEFSPDWLILQALHPVFEGDNVILRC
QGKDNKNTHQKVYYKDGKQLPNSYNLEKITVNSVSRDNSKYHCTAYRKFYILDIEVTSKP
LNIQVQELFLHPVLRASSSTPIEGSPMTLTCETQLSPQRPDVQLQFSLFRDSQTLGLGWS
RSPRLQIPAMWTEDSGSYWCEVETVTHSIKKRSLRSQIRVQRVPVSNVNLEIRPTGGQLI
EGENMVLICSVAQGSGTVTFSWHKEGRVRSLGRKTQRSLLAELHVLTVKESDAGRYYCAA
DNVHSPILSTWIRVTVRIPVSHPVLTFRAPRAHTVVGDLLELHCESLRGSPPILYRFYHE
DVTLGNSSAPSGGGASFNLSLTAEHSGNYSCDADNGLGAQHSHGVSLRVTVPVSRPVLTL
RAPGAQAVVGDLLELHCESLRGSFPILYWFYHEDDTLGNISAHSGGGASFNLSLTTEHSG
NYSCEADNGLGAQHSKVVTLNVTGTSRNRTGLTAAGITGLVLSILVLAAAAALLHYARAR
RKPGGLSATGTSSHSPSECQEPSSSRPSRIDPQEPTHSKPLAPMELEPMYSNVNPGDSNP
IYSQIWSIQHTKENSANCPMMHQEHEELTVLYSELKKTHPDDSAGEASSRGRAHEEDDEE
NYENVPRVLLASDH

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q96P31	1.000	1.000	0.000	734	1.000	1.000	Q96P31.pdb.gz	FCRL3_HUMAN Fc receptor-like protein 3 OS=Homo sapiens OX=9606 GN=FCRL3 PE=1 SV=1
2	AFDB:Q96RD9	0.324	0.248	6.836E-64	977	0.481	0.361	Q96RD9.pdb.gz	FCRL5_HUMAN Fc receptor-like protein 5 OS=Homo sapiens OX=9606 GN=FCRL5 PE=1 SV=3
3	AFDB:Q68SN8	0.403	0.475	1.917E-44	596	0.316	0.389	Q68SN8.pdb.gz	FCRL5_MOUSE Fc receptor-like protein 5 OS=Mus musculus OX=10090 GN=Fcrl5 PE=1 SV=3
4	AFDB:Q96PJ5	0.451	0.630	2.333E-39	515	0.301	0.429	Q96PJ5.pdb.gz	FCRL4_HUMAN Fc receptor-like protein 4 OS=Homo sapiens OX=9606 GN=FCRL4 PE=1 SV=1
5	AFDB:Q96LA6	0.355	0.599	8.514E-34	429	0.286	0.490	Q96LA6.pdb.gz	FCRL1_HUMAN Fc receptor-like protein 1 OS=Homo sapiens OX=9606 GN=FCRL1 PE=1 SV=1
6	AFDB:Q90YM1	0.212	0.195	3.398E-22	838	0.151	0.132	Q90YM1.pdb.gz
7	PDB:5oj2B	0.196	0.206	2.853E-19	692	0.163	0.173	5oj2B.pdb.gz
8	AFDB:Q96PQ1	0.248	0.294	6.743E-19	595	0.139	0.171	Q96PQ1.pdb.gz	SIG12_HUMAN Sialic acid-binding Ig-like lectin 12 OS=Homo sapiens OX=9606 GN=SIGLEC12 PE=1 SV=1
9	PDB:1e07A	0.247	0.271	2.601E-16	642	0.127	0.145	1e07A.pdb.gz
10	AFDB:P35331	0.127	0.080	8.468E-16	1284	0.149	0.085	P35331.pdb.gz	NRCAM_CHICK Neuronal cell adhesion molecule OS=Gallus gallus OX=9031 PE=1 SV=1
11	AFDB:A8WH80	0.154	0.113	1.511E-14	1091	0.117	0.079	A8WH80.pdb.gz
12	PDB:4rtdA	0.119	0.092	2.266E-13	1122	0.123	0.080	4rtdA.pdb.gz
13	PDB:5a42A	0.131	0.071	7.441E-13	1597	0.125	0.058	5a42A.pdb.gz
14	PDB:4lnvA	0.116	0.075	1.945E-12	1276	0.097	0.056	4lnvA.pdb.gz
15	AFDB:A0A2R8QME5	0.204	0.151	3.493E-12	1094	0.143	0.096	A0A2R8QME5.pdb.gz	A0A2R8QME5_DANRE Protocadherin 19 OS=Danio rerio OX=7955 GN=fc83e05 PE=1 SV=1
16	PDB:7q1yA	0.137	0.094	4.043E-12	1374	0.098	0.052	7q1yA.pdb.gz
17	PDB:4ziqA	0.131	0.082	5.319E-12	1450	0.119	0.060	4ziqA.pdb.gz
18	PDB:6h03A	0.147	0.107	8.798E-12	1223	0.106	0.064	6h03A.pdb.gz
19	PDB:7nycA	0.144	0.093	1.268E-11	1542	0.098	0.047	7nycA.pdb.gz	Structural basis of soluble membrane attack complex packaging for clearance.
20	PDB:7q5zA	0.137	0.091	5.482E-11	1344	0.094	0.051	7q5zA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q96P31	0.0	1516	734	1.000	1.000	FCRL3_HUMAN Fc receptor-like protein 3 OS=Homo sapiens OX=9606 GN=FCRL3 PE=1 SV=1
2	Q96LA5	1.51e-158	470	508	0.309	0.447	FCRL2_HUMAN Fc receptor-like protein 2 OS=Homo sapiens OX=9606 GN=FCRL2 PE=1 SV=1
3	Q96RD9	5.50e-148	458	977	0.349	0.262	FCRL5_HUMAN Fc receptor-like protein 5 OS=Homo sapiens OX=9606 GN=FCRL5 PE=1 SV=3
4	Q68SN8	1.83e-121	378	596	0.281	0.346	FCRL5_MOUSE Fc receptor-like protein 5 OS=Mus musculus OX=10090 GN=Fcrl5 PE=1 SV=3
5	Q96LA6	2.58e-114	353	429	0.238	0.408	FCRL1_HUMAN Fc receptor-like protein 1 OS=Homo sapiens OX=9606 GN=FCRL1 PE=1 SV=1
6	Q96PJ5	1.80e-100	320	515	0.234	0.334	FCRL4_HUMAN Fc receptor-like protein 4 OS=Homo sapiens OX=9606 GN=FCRL4 PE=1 SV=1
7	Q6BAA4	1.84e-44	167	426	0.138	0.237	FCRLB_HUMAN Fc receptor-like B OS=Homo sapiens OX=9606 GN=FCRLB PE=1 SV=1
8	Q5DRQ8	1.15e-42	162	427	0.127	0.218	FCRLB_MOUSE Fc receptor-like B OS=Mus musculus OX=10090 GN=Fcrlb PE=2 SV=2
9	P26151	4.28e-38	149	404	0.135	0.245	FCGR1_MOUSE High affinity immunoglobulin gamma Fc receptor I OS=Mus musculus OX=10090 GN=Fcgr1 PE=1 SV=1
10	A0A0B4J2J0	1.65e-36	142	353	0.129	0.269	A0A0B4J2J0_RAT Fc fragment of IgG receptor Ia OS=Rattus norvegicus OX=10116 GN=Fcgr1a PE=4 SV=1
11	P12314	3.03e-35	139	374	0.135	0.265	FCGR1_HUMAN High affinity immunoglobulin gamma Fc receptor I OS=Homo sapiens OX=9606 GN=FCGR1A PE=1 SV=2
12	Q6DN72	2.10e-32	132	434	0.128	0.217	FCRL6_HUMAN Fc receptor-like protein 6 OS=Homo sapiens OX=9606 GN=FCRL6 PE=1 SV=2
13	Q7L513	4.29e-32	130	359	0.113	0.231	FCRLA_HUMAN Fc receptor-like A OS=Homo sapiens OX=9606 GN=FCRLA PE=1 SV=2
14	Q920A9	2.13e-27	116	352	0.098	0.205	FCRLA_MOUSE Fc receptor-like A OS=Mus musculus OX=10090 GN=Fcrla PE=1 SV=1
15	P12319	1.88e-22	99.8	257	0.091	0.261	FCERA_HUMAN High affinity immunoglobulin epsilon receptor subunit alpha OS=Homo sapiens OX=9606 GN=FCER1A PE=1 SV=1
16	A1YIY0	3.38e-20	93.2	268	0.086	0.235	FCRL6_MOUSE Fc receptor-like protein 6 OS=Mus musculus OX=10090 GN=Fcrl6 PE=2 SV=2
17	P31994	3.96e-20	94.0	310	0.082	0.194	FCG2B_HUMAN Low affinity immunoglobulin gamma Fc region receptor II-b OS=Homo sapiens OX=9606 GN=FCGR2B PE=1 SV=2
18	P31995	6.13e-20	94.0	323	0.082	0.186	FCG2C_HUMAN Low affinity immunoglobulin gamma Fc region receptor II-c OS=Homo sapiens OX=9606 GN=FCGR2C PE=1 SV=1
19	P27645	8.71e-20	92.0	267	0.094	0.258	FCGR3_RAT Low affinity immunoglobulin gamma Fc region receptor III OS=Rattus norvegicus OX=10116 GN=Fcgr3 PE=2 SV=1
20	P16284	2.55e-19	95.1	738	0.173	0.172	PECA1_HUMAN Platelet endothelial cell adhesion molecule OS=Homo sapiens OX=9606 GN=PECAM1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF08205 C2-set_2	1.3	20.4	CD80-like C2-set immunoglobulin domain
2	PF03351 DOMON	5.9e+02	12.1	DOMON domain
3	PF07679 I-set	2e-12	58.3	Immunoglobulin I-set domain
4	PF00047 ig	2.8e-25	99.6	Immunoglobulin domain
5	PF13895 Ig_2	2.7e-47	170.3	Immunoglobulin domain
6	PF13927 Ig_3	4e-39	144.4	Immunoglobulin domain
7	PF16680 Ig_4	0.00011	34.1	T-cell surface glycoprotein CD3 delta chain
8	PF17736 Ig_C17orf99	1.3e-14	65.3	C17orf99 Ig domain
9	PF16706 Izumo-Ig	0.013	26.7	Izumo-like Immunoglobulin domain
10	PF15437 PGBA_C	6.7e+02	12.1	Plasminogen-binding protein pgbA C-terminal
11	PF19428 Sema4F_C	2e+02	12.8	Semaphorin 4F C-terminal
12	PF07686 V-set	5.3e-08	44.4	Immunoglobulin V-set domain
13	PF08204 V-set_CD47	0.12	23.7	CD47 immunoglobulin-like domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000357167

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000364907	0.821	Tyrosine-protein kinase SYK
2	9606.ENSP00000352833	0.791	Tyrosine-protein phosphatase non-receptor type 22
3	9606.ENSP00000348888	0.765	Polymeric immunoglobulin receptor
4	9606.ENSP00000364597	0.605	Protein-arginine deiminase type-4
5	9606.ENSP00000353099	0.595	HLA class II histocompatibility antigen, DRB1-15 beta chain
6	9606.ENSP00000441235	0.586	Thyrotropin receptor
7	9606.ENSP00000391592	0.566	Tyrosine-protein phosphatase non-receptor type 6
8	9606.ENSP00000340944	0.543	Tyrosine-protein phosphatase non-receptor type 11
9	9606.ENSP00000303939	0.539	Cytotoxic T-lymphocyte protein 4
10	9606.ENSP00000484824	0.507	Mucin-1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0019903	0.995	protein phosphatase binding
GO:0019901	0.947	protein kinase binding
GO:1990782	0.919	protein tyrosine kinase binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.990	regulation of cellular process
GO:0048518	0.985	positive regulation of biological process
GO:0009987	0.978	cellular process
GO:0048522	0.961	positive regulation of cellular process
GO:0051249	0.930	regulation of lymphocyte activation
GO:0019222	0.918	regulation of metabolic process
GO:0002683	0.901	negative regulation of immune system process
GO:0050896	0.890	response to stimulus
GO:0048583	0.885	regulation of response to stimulus
GO:0060255	0.884	regulation of macromolecule metabolic process
GO:0010646	0.878	regulation of cell communication
GO:0048523	0.840	negative regulation of cellular process
GO:0080090	0.831	regulation of primary metabolic process
GO:0051174	0.825	regulation of phosphorus metabolic process
GO:0051171	0.823	regulation of nitrogen compound metabolic process
GO:0023051	0.821	regulation of signaling
GO:0009966	0.794	regulation of signal transduction
GO:0019220	0.780	regulation of phosphate metabolic process
GO:0050776	0.777	regulation of immune response
GO:0002684	0.775	positive regulation of immune system process
GO:0002697	0.759	regulation of immune effector process
GO:0051716	0.752	cellular response to stimulus
GO:0009892	0.742	negative regulation of metabolic process
GO:0031399	0.739	regulation of protein modification process
GO:0002376	0.720	immune system process
GO:0050854	0.715	regulation of antigen receptor-mediated signaling pathway
GO:0010468	0.714	regulation of gene expression
GO:0007154	0.698	cell communication
GO:0048584	0.691	positive regulation of response to stimulus
GO:0010605	0.691	negative regulation of macromolecule metabolic process
GO:0007165	0.676	signal transduction
GO:0065009	0.675	regulation of molecular function
GO:0051924	0.659	regulation of calcium ion transport
GO:0009893	0.642	positive regulation of metabolic process
GO:0051240	0.640	positive regulation of multicellular organismal process
GO:0010604	0.625	positive regulation of macromolecule metabolic process
GO:0032501	0.620	multicellular organismal process
GO:0002831	0.611	regulation of response to biotic stimulus
GO:0031347	0.611	regulation of defense response
GO:0042127	0.603	regulation of cell population proliferation
GO:0051247	0.597	positive regulation of protein metabolic process
GO:0002696	0.581	positive regulation of leukocyte activation
GO:0032101	0.570	regulation of response to external stimulus
GO:0045088	0.540	regulation of innate immune response
GO:0051251	0.536	positive regulation of lymphocyte activation
GO:0070663	0.527	regulation of leukocyte proliferation
GO:0031325	0.475	positive regulation of cellular metabolic process
GO:0007166	0.462	cell surface receptor signaling pathway
GO:0050793	0.454	regulation of developmental process
GO:0044093	0.436	positive regulation of molecular function
GO:0031401	0.436	positive regulation of protein modification process
GO:0048585	0.433	negative regulation of response to stimulus
GO:0060284	0.429	regulation of cell development
GO:0050790	0.421	regulation of catalytic activity
GO:0023056	0.400	positive regulation of signaling
GO:0010647	0.400	positive regulation of cell communication
GO:1902531	0.400	regulation of intracellular signal transduction
GO:0032502	0.378	developmental process
GO:0035303	0.367	regulation of dephosphorylation
GO:0050670	0.341	regulation of lymphocyte proliferation
GO:0048856	0.335	anatomical structure development
GO:0002698	0.320	negative regulation of immune effector process
GO:0050864	0.313	regulation of B cell activation
GO:0010629	0.310	negative regulation of gene expression
GO:0002764	0.307	immune response-regulating signaling pathway
GO:0002768	0.302	immune response-regulating cell surface receptor signaling pathway

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009986	0.998	cell surface
GO:0071944	0.871	cell periphery
GO:0016020	0.457	membrane
GO:0005886	0.446	plasma membrane
GO:0005622	0.377	intracellular anatomical structure
GO:0043227	0.329	membrane-bounded organelle
GO:0043231	0.314	intracellular membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]